BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30823 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 25 2.4 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 7.4 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 23 9.8 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 23 9.8 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 9.8 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 414 DIERWTNLLPSRQFGYLVLTTSGGIMDHEEARENT 518 D W N G LVL + G++D ++ E T Sbjct: 198 DFNEWLNRWAFETMGVLVLDSRLGVLDKDQTPEVT 232 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.0 bits (47), Expect = 7.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 160 AMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSK 258 A+ +N+L+ + A+KR + Q L+R C K Sbjct: 598 ALRTLNLLNRSTDHALLAQKRQEHQRLVRECDK 630 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 22.6 bits (46), Expect = 9.8 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +3 Query: 399 DVPINDIERWTN 434 D+P +D E+WT+ Sbjct: 165 DIPFSDFEQWTS 176 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 22.6 bits (46), Expect = 9.8 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +3 Query: 399 DVPINDIERWTN 434 D+P +D E+WT+ Sbjct: 165 DIPFSDFEQWTS 176 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 22.6 bits (46), Expect = 9.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 402 VPINDIERWTNLLPSRQFGYLVLTTSGGIMDHEEAR 509 V +ND+ERW + + VL SG + +E R Sbjct: 304 VSVNDLERWRDRIHEAIDQGFVLDKSGNRIMLDEQR 339 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,779 Number of Sequences: 2352 Number of extensions: 9226 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -