BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30823 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 2.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 3.9 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.2 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 23.0 bits (47), Expect = 2.3 Identities = 16/64 (25%), Positives = 27/64 (42%) Frame = +1 Query: 40 QEKACASKGEDDEGIDIRVK*KIYTIKSQFGSLRSAS*ILAMVRMNVLSDALKSIHNAEK 219 + C+ G +K + + FGS+ A I+ ++ + SI NAE+ Sbjct: 168 ENNTCSISNSYTNGCVEALKDTVKLAGTVFGSVAIAIAIVELIGIICALCLANSIKNAER 227 Query: 220 RGKR 231 RG R Sbjct: 228 RGYR 231 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.3 Identities = 6/20 (30%), Positives = 15/20 (75%) Frame = -1 Query: 338 ASSVIINDFKLSDVTVLHHH 279 A+ +++ F++ +VT++ HH Sbjct: 344 ANVAVLHSFQMKNVTIVDHH 363 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +1 Query: 478 VVASWTMKKPERTPWRKNFRLLFLSLLNTRQNVRKKKK 591 ++ +W + P + R +FL L T +R+ KK Sbjct: 316 IIINWNFRGPRTHRMPQLIRKIFLKYLPTILMMRRPKK 353 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 229 FSLAFQHYV*ILRRHSIRSYAPWLRF 152 F LAF + + ++ I WLRF Sbjct: 56 FGLAFVQLINVNEKNQIMKSNVWLRF 81 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 514 FSLASSWSMMPPLVV 470 +SLASSW + PL + Sbjct: 434 YSLASSWPALVPLAL 448 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,351 Number of Sequences: 438 Number of extensions: 2539 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -