BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30819 (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 146 9e-36 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 28 2.7 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 27 8.3 SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 8.3 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 146 bits (353), Expect = 9e-36 Identities = 69/98 (70%), Positives = 79/98 (80%) Frame = +2 Query: 26 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 205 MT+KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 206 MFQLPKLYAKLHYCVSSPSTAKLSGTDRRKTEESVLLP 319 ++ LPKLY KLHYCVS +K+ +R K + + P Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVV-RNRSKEDRKIRTP 97 Score = 44.4 bits (100), Expect = 4e-05 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +1 Query: 256 AIHSKVVRNRSKKDRRIRTPP 318 AIHSKVVRNRSK+DR+IRTPP Sbjct: 78 AIHSKVVRNRSKEDRKIRTPP 98 >SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) Length = 558 Score = 28.3 bits (60), Expect = 2.7 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = -2 Query: 208 HWVYRGIVN------ISDRRRFYDVPNHELFDSLVLWH-APRAVCASHS 83 H+ RGI N +S+RR+F V N E D +VL H P+A C+ S Sbjct: 441 HYGIRGIANEWFSSYLSNRRQFVSVNNSE-SDEVVLTHGVPQAKCSIQS 488 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 26.6 bits (56), Expect = 8.3 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +2 Query: 26 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 205 M ++ N K+ R + TNC +K K +NI+ + D D+S+YP Sbjct: 1819 MLYRQNNWYYIKNSRNTEGFIPFTNCIAEDEYEKRQNKLSRQNIIRNTSFLDSMDSSIYP 1878 >SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 842 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 113 VPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 226 + K K + VI + A AV D++ +VYP+F P L Sbjct: 47 IVKKKRNEGKVIYLFIGALAVTDVSLLAVYPLFAFPVL 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,230,184 Number of Sequences: 59808 Number of extensions: 202674 Number of successful extensions: 471 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -