BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30817X (496 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 29 0.29 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 26 3.6 SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1||... 25 8.3 SPCC285.10c |||SPRY domain protein|Schizosaccharomyces pombe|chr... 25 8.3 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 25 8.3 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 29.5 bits (63), Expect = 0.29 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 434 HNPVLRLHYLNLSREFRSLARGGGDL--RNRFTLSMVSSLVSEVRN 303 HNP L L +SRE SL D + R TL +S+LVS +N Sbjct: 255 HNPSTLLSILPISRELNSLLNRIFDRNPKTRITLPELSTLVSNCKN 300 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.8 bits (54), Expect = 3.6 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -2 Query: 483 SIKLITSNKRMWWMFATQSC 424 S+ +T+N +WW++A C Sbjct: 390 SLTTVTTNTNIWWVWAESRC 409 >SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1116 Score = 24.6 bits (51), Expect = 8.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 313 SLTRLDTMLRVNLFLRSPPPRAKLLNS 393 SL+ L LR + +R PP +K++NS Sbjct: 685 SLSPLSYRLRKSKHIRESPPSSKVINS 711 >SPCC285.10c |||SPRY domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 382 Score = 24.6 bits (51), Expect = 8.3 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 1 IGYQQERTKTIKNEIDHRCSSRPCGYRHRCP 93 +GY+ + + RC+ PC YR+ P Sbjct: 235 VGYKPKCNRIFFTRNGRRCAELPCTYRNLYP 265 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 24.6 bits (51), Expect = 8.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 280 TLTANLKPLRTSLTRLDTMLRVNLFLRSPPPRAKLLNSL 396 TLTA+L+ T L+T L+ + PP L++S+ Sbjct: 139 TLTASLERATQPPTNLETALQFRVIRTIPPNSLDLMHSV 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,892,073 Number of Sequences: 5004 Number of extensions: 34058 Number of successful extensions: 94 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -