BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30814 (796 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1009 - 10253409-10255033,10255301-10255610,10255707-102563... 28 7.4 07_03_0966 - 23016581-23016772,23017242-23017427,23017537-230176... 28 7.4 >12_01_1009 - 10253409-10255033,10255301-10255610,10255707-10256312, 10256359-10256487 Length = 889 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 122 RTTLKETTIHYKFHL--E*SAPIYCKNLCFSILFSECTTT 235 RT + E +H HL S PI CK L ++ S TTT Sbjct: 466 RTIVSEDIVHSLLHLISNTSPPIQCKLLEIFVMLSSSTTT 505 >07_03_0966 - 23016581-23016772,23017242-23017427,23017537-23017653, 23017930-23018084,23018785-23019039,23019226-23019304, 23019503-23019714,23020644-23020698 Length = 416 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 364 DLKSKHKFESQIITRTKTPLQTSNVKTFYIGT*M*KPVLQFIKRGSALR 218 DL+ KH+F+ + +T T PL+T + IG + L +K + L+ Sbjct: 19 DLREKHQFDLERLTLTSQPLRTLALFALAIGQSIKSTCLCVLKDSARLK 67 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,890,736 Number of Sequences: 37544 Number of extensions: 317338 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -