BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30814 (796 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC009255-1|AAH09255.1| 618|Homo sapiens asparagine-linked glyco... 32 2.1 AK025498-1|BAB15154.1| 618|Homo sapiens protein ( Homo sapiens ... 32 2.1 AF395532-1|AAL25798.1| 611|Homo sapiens DIBD1 protein. 32 2.1 >BC009255-1|AAH09255.1| 618|Homo sapiens asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha- 1,2-mannosyltr protein. Length = 618 Score = 32.3 bits (70), Expect = 2.1 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 201 VLVFYFLSALPRFINCKTGFYIHVPI*NVFTLEVCNGVLVLVII*DSNLC 350 +LVFYFL L F++C Y + + F L V +L +++ C Sbjct: 136 ILVFYFLRCLLAFVSCICELYFYKAVCKKFGLHVSRMMLAFLVLSTGMFC 185 >AK025498-1|BAB15154.1| 618|Homo sapiens protein ( Homo sapiens cDNA: FLJ21845 fis, clone HEP01884. ). Length = 618 Score = 32.3 bits (70), Expect = 2.1 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 201 VLVFYFLSALPRFINCKTGFYIHVPI*NVFTLEVCNGVLVLVII*DSNLC 350 +LVFYFL L F++C Y + + F L V +L +++ C Sbjct: 136 ILVFYFLRCLLAFVSCICELYFYKAVCKKFGLHVSRMMLAFLVLSTGMFC 185 >AF395532-1|AAL25798.1| 611|Homo sapiens DIBD1 protein. Length = 611 Score = 32.3 bits (70), Expect = 2.1 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 201 VLVFYFLSALPRFINCKTGFYIHVPI*NVFTLEVCNGVLVLVII*DSNLC 350 +LVFYFL L F++C Y + + F L V +L +++ C Sbjct: 136 ILVFYFLRCLLAFVSCICELYFYKAVCKKFGLHVSRMMLAFLVLSTGMFC 185 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,277,871 Number of Sequences: 237096 Number of extensions: 1967229 Number of successful extensions: 2934 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2934 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -