BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30813X (313 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5BHI3 Cluster: Serpentine receptor, class sx protein 3... 31 6.6 >UniRef50_Q5BHI3 Cluster: Serpentine receptor, class sx protein 34, isoform c; n=1; Caenorhabditis elegans|Rep: Serpentine receptor, class sx protein 34, isoform c - Caenorhabditis elegans Length = 299 Score = 30.7 bits (66), Expect = 6.6 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 1 ADSRTSRGTIMFI*HLFYTLALSSFIVKLILVFTSVIVYRSNC 129 ADS + G I+F HLF+ + S F+ L+ + T + V +C Sbjct: 51 ADSLHNYGQIIFTAHLFFDIQTSHFVCTLLNIPTLIGVISGSC 93 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 267,715,533 Number of Sequences: 1657284 Number of extensions: 4163764 Number of successful extensions: 9370 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9369 length of database: 575,637,011 effective HSP length: 80 effective length of database: 443,054,291 effective search space used: 10190248693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -