BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30813X (313 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hor... 25 0.14 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 0.56 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 1.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 20 5.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 6.9 >EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hormone 1 protein. Length = 73 Score = 25.4 bits (53), Expect = 0.14 Identities = 11/52 (21%), Positives = 24/52 (46%) Frame = +1 Query: 73 FIVKLILVFTSVIVYRSNCKSEWR*RN*NKFSDHGNNGRALVREVYCIQKYV 228 F++ +++ F V + N ++W R+ + NN + V + I K + Sbjct: 5 FLIVVLIAFVGVCTAQLNFSTDWGKRSGSSAGSDANNCKEPVETIMLIYKII 56 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 23.4 bits (48), Expect = 0.56 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = -1 Query: 280 SVIILKIKTQLWLNINNERIFEYNKLRAQAPYRCYRGR*TYFSFVTATRFCNSN 119 S+I+ +KT+ W +NN+ + KL+ + + YF V + +S+ Sbjct: 94 SIILGSLKTKEWAKLNNKFQYIDEKLKTRDQKERNLFKNAYFQLVLSISVYSSS 147 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.8 bits (44), Expect = 1.7 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 277 VIILKIKTQLWLNINNERIFEYNKLRAQAPYRC 179 V++L LW++ R+F+Y R+ Y C Sbjct: 125 VLLLLFDAYLWISSVGVRMFQYYIGRSFTYYVC 157 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 20.2 bits (40), Expect = 5.3 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +1 Query: 28 IMFI*HLFYTLALSSFIVKLILVFTSVIVY 117 I+F HL + L + F+V L + Y Sbjct: 121 IIFTVHLLFLLCIYYFVVPLFFLLCIYYFY 150 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 19.8 bits (39), Expect = 6.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 247 WLNINNERIFEYN 209 WL +NNE YN Sbjct: 425 WLYLNNEGSLVYN 437 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,471 Number of Sequences: 336 Number of extensions: 1059 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5730534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -