BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30810X (500 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0298 + 14080353-14080927,14081041-14081554 28 4.8 04_03_0293 - 14001443-14001956,14002070-14002644 28 4.8 11_01_0329 + 2471015-2471075,2471152-2471432 27 8.5 05_04_0454 + 21383068-21384525 27 8.5 02_05_0975 + 33227431-33227730,33228556-33228636,33228883-332296... 27 8.5 >04_03_0298 + 14080353-14080927,14081041-14081554 Length = 362 Score = 27.9 bits (59), Expect = 4.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +1 Query: 7 LKYVTVACVLVALCSGAPQQNPQDVQILRFDSNVEPDGYSFAY 135 L +V VA VLV L G V L+F + PDG AY Sbjct: 314 LLFVAVAGVLVDLIMGTGGNVAPPVTDLKFHTATMPDGMQLAY 356 >04_03_0293 - 14001443-14001956,14002070-14002644 Length = 362 Score = 27.9 bits (59), Expect = 4.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +1 Query: 7 LKYVTVACVLVALCSGAPQQNPQDVQILRFDSNVEPDGYSFAY 135 L +V VA VLV L G V L+F + PDG AY Sbjct: 314 LLFVAVAGVLVDLIMGTGGNVAPPVTDLKFHTATMPDGMQLAY 356 >11_01_0329 + 2471015-2471075,2471152-2471432 Length = 113 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 43 LCSGAPQQNPQDVQILRFDSNVEPDGYSFAYETSDGT 153 LC +Q+P D+ + SN D + Y SDGT Sbjct: 63 LCGDGKKQSPIDIVTKQAISNPNLDSLNRTYTASDGT 99 >05_04_0454 + 21383068-21384525 Length = 485 Score = 27.1 bits (57), Expect = 8.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 199 AALTVTGQYAYVAPDGKH*LSLSQRDPTASNPKPHWARS*NP 324 AA TVT ++ A DG H ++ S R T S P ++ +P Sbjct: 139 AASTVTTPCSHAADDGGHGVTTSPRTTTTSLPDSRGMKTLSP 180 >02_05_0975 + 33227431-33227730,33228556-33228636,33228883-33229680, 33230829-33231005,33231159-33231274,33231422-33231520, 33231598-33232040,33232147-33232184,33232343-33232600, 33233378-33233525,33233989-33234108,33234884-33234984, 33235090-33235213,33235386-33235498,33236103-33236214, 33236298-33236432,33236527-33236593,33236685-33236741, 33236774-33236900,33237221-33237338,33237418-33237929 Length = 1347 Score = 27.1 bits (57), Expect = 8.5 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -3 Query: 258 QLVLAVRSYVSILSSNCQSCILGLWVVEFAFFLS--GCTITSFVRKAVAIGFH 106 +L A SY+ + C+ C+L L +V + L+ C+ITS + +A H Sbjct: 992 RLTDACGSYLFTILQKCKECVLCLHIVTALYSLNVEQCSITSRTVQKMADALH 1044 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,199,814 Number of Sequences: 37544 Number of extensions: 287003 Number of successful extensions: 702 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -