BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30810X (500 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 0.63 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 24 2.5 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 24 2.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 2.5 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 23 7.7 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 23 7.7 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 7.7 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 26.2 bits (55), Expect = 0.63 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 98 TATWNPMATALRTKLV 145 TA+W +ATALRTK V Sbjct: 577 TASWQAIATALRTKRV 592 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 24.2 bits (50), Expect = 2.5 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 7 LKYVTVACVLVA 42 LKY+T+ACVL A Sbjct: 6 LKYITLACVLAA 17 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 24.2 bits (50), Expect = 2.5 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 7 LKYVTVACVLVA 42 LKY+T+ACVL A Sbjct: 6 LKYITLACVLAA 17 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 2.5 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = +1 Query: 112 PDGYSFAYETSDGTSRQEEGKLDNPQSENAALTVTGQYAYVAPDGKH 252 P Y F+Y D + G + + V GQY+ + DG H Sbjct: 89 PANYEFSYSVHD----EHTGDIKSQHETRHGDEVHGQYSLLDSDGHH 131 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 22.6 bits (46), Expect = 7.7 Identities = 12/48 (25%), Positives = 27/48 (56%) Frame = +3 Query: 288 QPKTSLGQKLKPQKPVDIQNTPSQYKLDNDFVGS*EISMLSSNLVMSS 431 +P+ ++GQ++ +D+ + P Q L + + S+LSS V+++ Sbjct: 39 RPRYAVGQRIVGGFEIDVSDAPYQVSLQYNKRHNCGGSVLSSKWVLTA 86 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 22.6 bits (46), Expect = 7.7 Identities = 12/48 (25%), Positives = 27/48 (56%) Frame = +3 Query: 288 QPKTSLGQKLKPQKPVDIQNTPSQYKLDNDFVGS*EISMLSSNLVMSS 431 +P+ ++GQ++ +D+ + P Q L + + S+LSS V+++ Sbjct: 39 RPRYAVGQRIVGGFEIDVSDAPYQVSLQYNKRHNCGGSVLSSKWVLTA 86 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 22.6 bits (46), Expect = 7.7 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +1 Query: 61 QQNPQDVQILRFDSNVEPDGYSFAYETSDGTSRQEEGKLDNPQSE 195 Q PQ ++ S+ F E D T EE NP E Sbjct: 315 QHQPQQQHQQQYHSHPHHTPVQFKTELHDNTQYDEELSPQNPDDE 359 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,122 Number of Sequences: 2352 Number of extensions: 11197 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -