BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30805 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_32272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_34880| Best HMM Match : Methuselah_N (HMM E-Value=9.6) 28 7.3 SB_20019| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_16856| Best HMM Match : HCaRG (HMM E-Value=1.1e-34) 27 9.7 >SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 368 YQPQSELLPVAPPMPEAIRRAIDYILAHPPKTETVKK 478 Y+ QS LP PP P A+ +D++ AH P + T+++ Sbjct: 54 YRHQSSSLPTLPP-PVALIN-LDFVAAHSPHSPTIRR 88 >SB_32272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +3 Query: 201 DGFSFGYETDNGISAQSSDP*RKLIISMFSPSKVNMNTLRLTEPL*SSRI 350 +G+ GY T GIS+ + P + S+ S S ++T ++PL SRI Sbjct: 106 NGYHTGYSTSTGISSTTLTP--SVTCSLTSSSAFPLSTTISSQPLYRSRI 153 >SB_34880| Best HMM Match : Methuselah_N (HMM E-Value=9.6) Length = 343 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 490 LDLSLFHGFGLRWVSENVVNSATDGFRHWRSNWK 389 +D + F ++ + NV+N A F+ W +WK Sbjct: 148 VDYQVVGSFIIQHETTNVINEALQKFKEWNLSWK 181 >SB_20019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 224 N*QWNQRSII*SLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYTADE 361 N +W ++ S ++D++ IQ ++ +PDG V FT T+D+ Sbjct: 133 NLEWRVDYVLGS-SELDDVKEPEIQLKFNKGSPDGEVVAFTVTSDK 177 >SB_16856| Best HMM Match : HCaRG (HMM E-Value=1.1e-34) Length = 196 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 224 N*QWNQRSII*SLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYTADE 361 N +W ++ S ++D++ IQ ++ +PDG V FT T+D+ Sbjct: 133 NLEWRVDYVLGS-SELDDVKEPEIQLKFNKGSPDGEVVAFTVTSDK 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,697,835 Number of Sequences: 59808 Number of extensions: 299861 Number of successful extensions: 759 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -