BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30805 (636 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein. 33 0.85 AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein. 33 0.85 U29895-1|AAC73008.1| 393|Homo sapiens 4-hydroxyphenylpyruvate-d... 30 6.0 >BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein. Length = 1192 Score = 33.1 bits (72), Expect = 0.85 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +2 Query: 302 QYEYSAPDGTPVKFTYTADENGYQPQSELLPVAPPMPEAIRRAIDYILAHPP 457 QY+Y P F+ + N P+ + +P PPMP + + + PP Sbjct: 50 QYQYEPPSAPSTTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRPP 101 >AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein. Length = 1374 Score = 33.1 bits (72), Expect = 0.85 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +2 Query: 302 QYEYSAPDGTPVKFTYTADENGYQPQSELLPVAPPMPEAIRRAIDYILAHPP 457 QY+Y P F+ + N P+ + +P PPMP + + + PP Sbjct: 50 QYQYEPPSAPSTTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRPP 101 >U29895-1|AAC73008.1| 393|Homo sapiens 4-hydroxyphenylpyruvate-dioxygenase protein. Length = 393 Score = 30.3 bits (65), Expect = 6.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 365 GYQPQSELLPVAPPMPEAIRRAIDYILAHPPKTETV 472 GY+P + + P+ P +P+ ID+I+ + P E V Sbjct: 159 GYEPPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMV 194 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,802,337 Number of Sequences: 237096 Number of extensions: 1569620 Number of successful extensions: 3281 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3279 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6972732040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -