BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30802 (803 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12570.1 68414.m01459 glucose-methanol-choline (GMC) oxidored... 37 0.014 At1g14190.1 68414.m01679 glucose-methanol-choline (GMC) oxidored... 36 0.042 At3g56060.1 68416.m06229 glucose-methanol-choline (GMC) oxidored... 34 0.096 At1g14185.1 68414.m01678 glucose-methanol-choline (GMC) oxidored... 34 0.096 At1g72970.1 68414.m08439 glucose-methanol-choline (GMC) oxidored... 33 0.22 At5g51950.1 68418.m06447 glucose-methanol-choline (GMC) oxidored... 33 0.29 At5g44790.1 68418.m05491 copper-exporting ATPase / responsive-to... 31 0.68 At5g51930.1 68418.m06442 glucose-methanol-choline (GMC) oxidored... 31 0.90 At5g27770.1 68418.m03330 60S ribosomal protein L22 (RPL22C) ribo... 30 2.1 At3g05560.2 68416.m00614 60S ribosomal protein L22-2 (RPL22B) id... 30 2.1 At3g05560.1 68416.m00613 60S ribosomal protein L22-2 (RPL22B) id... 30 2.1 At1g73370.1 68414.m08492 sucrose synthase, putative / sucrose-UD... 29 2.7 At5g23890.1 68418.m02806 expressed protein weak similarity to SP... 29 3.6 At2g01190.1 68415.m00030 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.6 At4g29440.1 68417.m04203 expressed protein contains Pfam profil... 29 4.8 At4g20870.1 68417.m03027 fatty acid hydroxylase, putative simila... 29 4.8 At1g77460.1 68414.m09020 C2 domain-containing protein / armadill... 28 8.3 At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to a... 28 8.3 >At1g12570.1 68414.m01459 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 572 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 357 FSLITLLHPESRGKISLKSSNPEDPPIIYSGYFTNENDLDNFARYLE 497 F L ++ P S G + LK+ NP+D PI+ YF + +DL R ++ Sbjct: 401 FLLEKVMGPLSTGHLELKTRNPKDNPIVTFNYFQHPDDLKRCVRGIQ 447 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 1 VGPKQHLEDMNISLVVDSPNVGGNMQDH 84 VGP L+ NI++V+D P+VG M D+ Sbjct: 291 VGPSAQLQAQNITVVMDQPHVGQGMYDN 318 >At1g14190.1 68414.m01679 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 501 Score = 35.5 bits (78), Expect = 0.042 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 381 PESRGKISLKSSNPEDPPIIYSGYFTNENDLD---NFARYLENFNTSSTV 521 P+S+G++ L S+NP + P + Y N+ DLD +L++ S TV Sbjct: 344 PKSKGRLKLNSTNPRENPSVKFNYLENKADLDACLEMVLHLQHVARSETV 393 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +1 Query: 1 VGPKQHLEDMNISLVVDSPNVGGNMQDHILVPVLL 105 +GP+ HL+D +I ++V+ VG M D+ + +L+ Sbjct: 262 IGPENHLKDFDIPVIVNLKEVGRKMSDNPAISLLV 296 >At3g56060.1 68416.m06229 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 577 Score = 34.3 bits (75), Expect = 0.096 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +3 Query: 381 PESRGKISLKSSNPEDPPIIYSGYFTNENDLDNFARYLENFNTSSTVHTSK 533 P SRG + L+++NP+D P + YF + DL+ + +E +T V SK Sbjct: 412 PLSRGHLELRNTNPDDNPSVTFNYFKDPEDLN---KCVEGLSTIIKVIDSK 459 >At1g14185.1 68414.m01678 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 503 Score = 34.3 bits (75), Expect = 0.096 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 381 PESRGKISLKSSNPEDPPIIYSGYFTNENDLD---NFARYLENFNTSSTV 521 P+S+G++ L ++NP + P + Y N+ DLD +L++ S TV Sbjct: 364 PKSKGRLKLNNTNPRENPSVTFNYLENKADLDACQEMVLHLQHVARSKTV 413 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 1 VGPKQHLEDMNISLVVDSPNVGGNMQDHILVPVLL 105 +GP+ HL D +I ++V+ VG M D+ + +L+ Sbjct: 282 IGPENHLNDFDIPVIVNLKEVGKQMSDNPAISLLV 316 >At1g72970.1 68414.m08439 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 594 Score = 33.1 bits (72), Expect = 0.22 Identities = 22/58 (37%), Positives = 30/58 (51%) Frame = +3 Query: 357 FSLITLLHPESRGKISLKSSNPEDPPIIYSGYFTNENDLDNFARYLENFNTSSTVHTS 530 F L L +P SRG +SL ++N +D P + YF + DL R +E S V TS Sbjct: 423 FILEKLAYPISRGHLSLVNTNVDDNPSVTFNYFKHPVDLQ---RCVEAIRLVSKVVTS 477 >At5g51950.1 68418.m06447 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 586 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 381 PESRGKISLKSSNPEDPPIIYSGYFTNENDLDNFARYLENFNTSSTVHTSK 533 P SRG + L+++NP+D P + Y+ DL +E NT V SK Sbjct: 421 PISRGHLELRNTNPDDNPSVRFNYYQEPEDLQ---ICVEGINTIIKVINSK 468 >At5g44790.1 68418.m05491 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) identical to SP|Q9S7J8 Length = 1001 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +1 Query: 22 EDMNISLVVDSPNVGG--NMQDHILVPVLLTGMESISSAISNIDPLLNMDKVPVPLILGF 195 E + +S VDSP +GG NM + + G +++ S I ++ M K P+ + Sbjct: 499 ESVPVSKEVDSPVIGGTINMHGALHMKATKVGSDAVLSQIISLVETAQMSKAPIQKFADY 558 Query: 196 VA 201 VA Sbjct: 559 VA 560 >At5g51930.1 68418.m06442 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 582 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 381 PESRGKISLKSSNPEDPPIIYSGYFTNENDLDNFARYL 494 P S+G + L+++NP D P + Y+ DL+ + L Sbjct: 437 PASKGHMKLRNTNPRDNPSVTFNYYQEPEDLNKCVKGL 474 >At5g27770.1 68418.m03330 60S ribosomal protein L22 (RPL22C) ribosomal protein L22 (cytosolic), Rattus norvegicus, PIR:S52084 Length = 124 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 355 TVSCPKPASDRAMHISSLNMSICEHISTG 269 T+ C KP D+ M I+SL + E I G Sbjct: 19 TIDCSKPVDDKIMEIASLEKFLQERIKVG 47 >At3g05560.2 68416.m00614 60S ribosomal protein L22-2 (RPL22B) identical to 60S ribosomal protein L22-2 SP:Q9M9W1 from [Arabidopsis thaliana] Length = 124 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 355 TVSCPKPASDRAMHISSLNMSICEHISTG 269 T+ C KP D+ M I+SL + E I G Sbjct: 19 TIDCSKPVDDKIMEIASLEKFLQERIKVG 47 >At3g05560.1 68416.m00613 60S ribosomal protein L22-2 (RPL22B) identical to 60S ribosomal protein L22-2 SP:Q9M9W1 from [Arabidopsis thaliana] Length = 124 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 355 TVSCPKPASDRAMHISSLNMSICEHISTG 269 T+ C KP D+ M I+SL + E I G Sbjct: 19 TIDCSKPVDDKIMEIASLEKFLQERIKVG 47 >At1g73370.1 68414.m08492 sucrose synthase, putative / sucrose-UDP glucosyltransferase, putative similar to sucrose synthase GI:6682841 from [Citrus unshiu] Length = 942 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 273 VLMCSQMLMLSDDICIALSEAGLGQETVFSLITLLHPESRG 395 V + Q+ L +++ I +++ GLG + ++T L PE+RG Sbjct: 310 VYILDQVRALEEELLIRINQQGLGFKPQILVVTRLIPEARG 350 >At5g23890.1 68418.m02806 expressed protein weak similarity to SP|P12957 Caldesmon (CDM) {Gallus gallus} Length = 946 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 372 LLHPESRGKISLKSSNPEDPPIIYSGYFTNENDLDNFARYLENFNTSS 515 LL ES + ++++N EDP + + TN +DL+N + + SS Sbjct: 245 LLDAESSNLVGVENTNSEDPESLLNTEPTNVSDLENHVNSQKEDSLSS 292 >At2g01190.1 68415.m00030 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein Pfam profile PF00564: PB1 domain Length = 720 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 214 QSYPDYQVTATVSPRPHFFP 273 Q YP Y VTA V PRP+ P Sbjct: 552 QPYPVYYVTAPVPPRPYSMP 571 >At4g29440.1 68417.m04203 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 1090 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 198 DKAQNERHRNLIHVQQRVYVADSRR 124 D+ + E HR+ H+Q R Y++ SRR Sbjct: 835 DEDEKEVHRDTAHIQTRPYISISRR 859 >At4g20870.1 68417.m03027 fatty acid hydroxylase, putative similar to fatty acid hydroxylase Fah1p GB:AF021804 GI:2736147 from [Arabidopsis thaliana] Length = 237 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 177 HRNLIHVQQRVYVADSRRYAFHSC 106 HR L H+Q + Y A++ Y H C Sbjct: 102 HRFLFHIQTKSYWANTAHYLLHGC 125 >At1g77460.1 68414.m09020 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2110 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -2 Query: 385 SGCSSVISENTVSCPKPASDRAMHISSLNMSICEHISTGRNEAVVK-LLQLLD 230 SG V+S + P ++ A ++ L +S C+ I N VVK L+QLL+ Sbjct: 188 SGVDIVVSLLSSDNPNSQANAASLLARLVLSFCDSIQKILNSGVVKSLIQLLE 240 >At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to aldehyde oxidases from Arabidopsis thaliana: GI:3172023, GI:3172025, GI:3172044; identical to cDNA putative aldehyde oxidase (AO2) mRNA, partial cds GI:2792305 Length = 1337 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = -1 Query: 185 MSGTGTLSMFNKG--SMLLIAEDMLSIPVSKTGTNMWSCMFPPTLGESTTKLMFISSKCC 12 ++ ++ M N G L + E ++S P+ T T + P + STT L+F + + Sbjct: 364 LAADASVHMINAGRHEKLRMGEYLVSPPILDTKTVLLKVHIPRWIASSTTGLLFETYRAA 423 Query: 11 LGP 3 L P Sbjct: 424 LRP 426 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,072,775 Number of Sequences: 28952 Number of extensions: 390706 Number of successful extensions: 950 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -