BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30800X (410 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 0.53 At5g65460.1 68418.m08232 kinesin motor protein-related contains ... 30 0.70 At5g64090.1 68418.m08049 expressed protein 27 4.9 At5g10470.1 68418.m01213 kinesin motor protein-related TH65 prot... 27 4.9 At5g60930.1 68418.m07643 chromosome-associated kinesin, putative... 27 6.5 At3g52250.1 68416.m05742 myb family transcription factor contain... 27 6.5 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 30.3 bits (65), Expect = 0.53 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 261 PLKRR*SFYPTQEKIRASSGGRHSA 335 P++RR S P +E++ S GGRH++ Sbjct: 525 PVRRRRSLTPDEERVSLSQGGRHTS 549 >At5g65460.1 68418.m08232 kinesin motor protein-related contains similarity to kinesin heavy chain Length = 1281 Score = 29.9 bits (64), Expect = 0.70 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 172 KKNPKPEKSNKLTVVVKQIRGEKNGGTRQ 258 K N KPEK +KL VV +IRG RQ Sbjct: 858 KVNLKPEKKSKLVSVVSRIRGHDQDTGRQ 886 >At5g64090.1 68418.m08049 expressed protein Length = 448 Score = 27.1 bits (57), Expect = 4.9 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +1 Query: 238 KNGGTRQYPSNVGSPSTPLRRKSVLHQVAVIQQSCAQDPIRPGDRKCLHS 387 K G PS+ S STP R KSV A P DR +HS Sbjct: 6 KPSGGSPSPSSSTSSSTPHRFKSVTTPTATAAAVSGFSPSAAADRDPMHS 55 >At5g10470.1 68418.m01213 kinesin motor protein-related TH65 protein, Arabidopsis thaliana, EMBL:AJ001729; contains Pfam profile PF00225: Kinesin motor domain Length = 1273 Score = 27.1 bits (57), Expect = 4.9 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 172 KKNPKPEKSNKLTVVVKQIRG-EKNGGTRQ 258 K N K E+ NKL VV ++RG E++ G +Q Sbjct: 858 KVNIKAERRNKLASVVSRMRGLEQDAGRQQ 887 >At5g60930.1 68418.m07643 chromosome-associated kinesin, putative microtubule-associated motor KIF4 , Mus musculus, PIR:A54803 Length = 1294 Score = 26.6 bits (56), Expect = 6.5 Identities = 13/69 (18%), Positives = 34/69 (49%) Frame = +1 Query: 121 FSKSKMFHKKAKYKFIGKKNPKPEKSNKLTVVVKQIRGEKNGGTRQYPSNVGSPSTPLRR 300 + K+ K K + ++ K E+++++T +K++ + +R+ S P T Sbjct: 716 YEMHKLMALNQKQKLVLQR--KTEEASQVTKRLKELLDNRKASSRETLSGANGPGTQALM 773 Query: 301 KSVLHQVAV 327 +++ H++ V Sbjct: 774 QAIEHEIEV 782 >At3g52250.1 68416.m05742 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 1677 Score = 26.6 bits (56), Expect = 6.5 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 22 SGGQACCSTCRWLTKKKSTIKPRNYDLGNGVMRFSKSKM 138 SG C+T L+++ S+ K + G G+ ++ K K+ Sbjct: 367 SGDATACATTTHLSEEMSSRKKQRLGWGEGLAKYEKKKV 405 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,860,629 Number of Sequences: 28952 Number of extensions: 203654 Number of successful extensions: 477 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 615542944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -