BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30798X (313 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 24 0.49 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 2.0 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 2.6 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 2.6 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 2.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 2.6 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 2.6 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 2.6 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 2.6 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 3.5 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 4.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 4.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 4.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 20 6.0 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 20 6.0 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 20 6.0 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 20 6.0 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 20 6.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 6.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 20 6.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 6.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 20 6.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 20 6.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 20 6.0 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 20 8.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 8.0 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.8 bits (49), Expect = 0.49 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = +2 Query: 89 DTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNAR 268 DT+D K R+ + + R R R +R NRM + + +K++N Sbjct: 502 DTMDRTDKMSRIDRMDK--IDRMDRMDRTNRMDRMNRMNRQMNEYMMALSMKLQKFINND 559 Query: 269 Y 271 Y Sbjct: 560 Y 560 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 2.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 41 KTNFGGGKSTGFALIYDTLDLA 106 KTN G S+G L+ + D+A Sbjct: 724 KTNLSGDSSSGTTLLLELDDIA 745 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 2.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +2 Query: 149 YEKKRPTRKQRKERKNRMKKVRGTKKSKVGAASKKYVNARY 271 Y+K R T K+R ++R ++ R + + + S Y + Y Sbjct: 56 YQKYRETSKERS--RDRTERERCKEPKIISSLSNNYKYSNY 94 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 3.5 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -3 Query: 134 LTCAWARTSWPDRVCRRSKRIQLTCHLRS 48 L ++ R P +C R LT H RS Sbjct: 107 LKFSYPRMRAPSFICENETRQGLTLHYRS 135 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +2 Query: 149 YEKKRPTRKQR-KERKNRMK 205 Y K R T K+R ++RK R K Sbjct: 56 YRKYRETSKERSRDRKEREK 75 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +2 Query: 149 YEKKRPTRKQR-KERKNRMK 205 Y K R T K+R ++RK R K Sbjct: 56 YRKYRETSKERSRDRKEREK 75 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +2 Query: 149 YEKKRPTRKQR-KERKNRMK 205 Y K R T K+R ++RK R K Sbjct: 56 YRKYRETSKERSRDRKEREK 75 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 153 RRRGPRANSVKNV 191 RRR PR NSV + Sbjct: 411 RRRTPRYNSVSKI 423 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSK 77 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSK 77 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSK 77 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSK 77 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 146 LYEKKRPTRKQRKERKNRMKKVRGTKKSK 232 LY+ +R RK + K R + +KSK Sbjct: 271 LYKNEREYRKYGETSKERSRNRTEREKSK 299 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 19.8 bits (39), Expect = 8.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 262 IHILLGGRTYFRF 224 + I+LGG TY+ F Sbjct: 70 VDIVLGGLTYWAF 82 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 19.8 bits (39), Expect = 8.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 164 PTRKQRKERKN 196 PTR+ RK R+N Sbjct: 262 PTRRLRKRRQN 272 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,970 Number of Sequences: 438 Number of extensions: 1934 Number of successful extensions: 28 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6595479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -