BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30796 (787 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3||... 29 0.57 SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyc... 28 1.3 SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 27 3.0 SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo... 26 5.3 SPAC16A10.07c |taz1|myb1, myb|human TRF ortholog Taz1|Schizosacc... 26 5.3 SPBC16H5.06 |rip1||ubiquinol-cytochrome-c reductase complex subu... 26 5.3 SPBC36.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||M... 26 5.3 SPAC23A1.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 7.0 SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 25 9.3 >SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 29.5 bits (63), Expect = 0.57 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -1 Query: 406 SDQDMNGIASPS---RPAEIMPLSQRTQKPRYSP 314 SD ++ G+ P +PA +PLS+R+ P Y+P Sbjct: 30 SDPELIGLLKPDNVDKPANSIPLSKRSTSPSYAP 63 >SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 28.3 bits (60), Expect = 1.3 Identities = 20/68 (29%), Positives = 30/68 (44%) Frame = -3 Query: 353 AAIPTNPKTTIFPSVKNSGAFNFNLIGLGSIFPMTLLAFPQPPIITSYIGSDSCGPVVSA 174 AA T FP F + + S+F ++LL P +TSY G D+ V++ Sbjct: 292 AAAETENPAKAFPVAVRQTLFRIAIFYILSLFIVSLLISGADPRLTSYHGVDASPFVLAI 351 Query: 173 MWASFAAL 150 A+ AL Sbjct: 352 KDANIKAL 359 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 27.1 bits (57), Expect = 3.0 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = +3 Query: 456 ATGSWKIEXXXXXXXXXXCTQHPLATLEATEETHPLRLEEPVYGLMFQEVKYLLAP 623 ATG+W T P+A ++ T E + L PVY L F Y+ P Sbjct: 204 ATGAWTASLLPNDHTRFLATGQPVAYIKLTPEEYIRFLTNPVY-LDFDTGFYIFPP 258 >SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1588 Score = 26.2 bits (55), Expect = 5.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 532 PWRLRRKRTPSVWRSR 579 PW R + TPSVW S+ Sbjct: 1511 PWNTRPRSTPSVWLSQ 1526 >SPAC16A10.07c |taz1|myb1, myb|human TRF ortholog Taz1|Schizosaccharomyces pombe|chr 1|||Manual Length = 663 Score = 26.2 bits (55), Expect = 5.3 Identities = 22/78 (28%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = +1 Query: 244 KSVIGKIEPSPIRLKLKAPEFLTEGNIVVFGFVGIAALSPLDARVK--LFHSYPGLIPNL 417 KS IG SP++L+ P F+ + F + L D VK L+ S I N Sbjct: 323 KSTIGNTSNSPLQLRASFPAFVNAVIHFLLEFKNVRRLERKDLSVKGMLYDSDSQQILNR 382 Query: 418 SQFTTSESAQAGVPQAPG 471 + S S +A G Sbjct: 383 LRERVSGSTAQSADEASG 400 >SPBC16H5.06 |rip1||ubiquinol-cytochrome-c reductase complex subunit 5|Schizosaccharomyces pombe|chr 2|||Manual Length = 228 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +1 Query: 226 GGW-----GNAKSVIGKIEPSPIRLKLKAPEFLTEGNIVVFG 336 GGW G+ + G+I P L L P + EG+ ++ G Sbjct: 187 GGWFCPCHGSHYDISGRIRRGPAPLNLAIPAYTFEGSKIIIG 228 >SPBC36.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 343 Score = 26.2 bits (55), Expect = 5.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 419 ERFGIRPGYEWNSFTLASSGDNAAIP 342 E+ G R GY+ +S ASS N+ IP Sbjct: 155 EKMGYRGGYQMHSTPWASSPRNSTIP 180 >SPAC23A1.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 101 Score = 25.8 bits (54), Expect = 7.0 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 217 VMIGGWGNAKSVIGKIEPSPIRLKLKAPEF 306 V + GW AKS+I K+ PS RL P F Sbjct: 57 VFLTGWA-AKSIIVKLLPSLWRLSTLIPSF 85 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 25.4 bits (53), Expect = 9.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 695 GSWHLREQHEPHTGALLSSPVLPQRRQEV 609 G HL+EQ +S P+LP ++ E+ Sbjct: 98 GVKHLQEQSSKEIKNPISQPILPNKKDEI 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,163,398 Number of Sequences: 5004 Number of extensions: 69299 Number of successful extensions: 204 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 204 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -