BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30795 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 30 0.021 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.4 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 7.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.4 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 29.9 bits (64), Expect = 0.021 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -3 Query: 673 ANSGLVQICKMAQVYPHPAPEGCTSASSESAPSDQPIYPDTG 548 A GL + ++ VYP+ C + E++ SD P +P G Sbjct: 178 ARHGLETLSQLMDVYPNNDGTKCLVVTDEASISDAPFFPHRG 219 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -3 Query: 631 YPHP--APEGCTSASSESAPSDQPIYPDTG 548 YP+P +PE A+S PS P+ P G Sbjct: 172 YPYPILSPEMSQVAASWHTPSMYPLSPGAG 201 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -3 Query: 631 YPHP--APEGCTSASSESAPSDQPIYPDTG 548 YP+P +PE A+S PS P+ P G Sbjct: 64 YPYPILSPEMSQVAASWHTPSMYPLSPGAG 93 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 425 TKEAQHHPIRHKHSHQA 375 TK HH I+ +H HQ+ Sbjct: 101 TKFNPHHEIKLQHLHQS 117 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 598 ASSESAPSDQPIYPD 554 ASS APS P+ PD Sbjct: 2288 ASSTMAPSTTPMVPD 2302 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,452 Number of Sequences: 336 Number of extensions: 2969 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -