BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30792X (381 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118515-1|AAM49884.1| 66|Drosophila melanogaster LD14731p pro... 52 2e-07 AE013599-996|AAO41466.1| 66|Drosophila melanogaster CG2249-PB,... 52 2e-07 AE013599-995|AAF58857.2| 66|Drosophila melanogaster CG2249-PA,... 52 2e-07 >AY118515-1|AAM49884.1| 66|Drosophila melanogaster LD14731p protein. Length = 66 Score = 52.4 bits (120), Expect = 2e-07 Identities = 22/54 (40%), Positives = 34/54 (62%) Frame = +2 Query: 92 SNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLI 253 S+ + RN + VR +GG+PGENLPF + N+Y++T F + G +P+LI Sbjct: 5 SSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLI 58 >AE013599-996|AAO41466.1| 66|Drosophila melanogaster CG2249-PB, isoform B protein. Length = 66 Score = 52.4 bits (120), Expect = 2e-07 Identities = 22/54 (40%), Positives = 34/54 (62%) Frame = +2 Query: 92 SNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLI 253 S+ + RN + VR +GG+PGENLPF + N+Y++T F + G +P+LI Sbjct: 5 SSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLI 58 >AE013599-995|AAF58857.2| 66|Drosophila melanogaster CG2249-PA, isoform A protein. Length = 66 Score = 52.4 bits (120), Expect = 2e-07 Identities = 22/54 (40%), Positives = 34/54 (62%) Frame = +2 Query: 92 SNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLYFILYAGSGLSAPYLI 253 S+ + RN + VR +GG+PGENLPF + N+Y++T F + G +P+LI Sbjct: 5 SSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLI 58 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,549,047 Number of Sequences: 53049 Number of extensions: 332489 Number of successful extensions: 666 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1024276155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -