BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30789 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 4.0 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.3 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 5.3 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 5.3 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.3 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.3 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 5.3 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 9.3 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 4.0 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 594 GASLELLSYFLSNI*NFSSSRPCLKNIMMVFAYHQSLYIPSWQPCHHN 451 GA F+ N+ S+S K I Y IP+W P +H+ Sbjct: 301 GADFPFNFAFIKNVSRDSNSSDFKKLIDNWMTYMPPSGIPNWVPGNHD 348 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 594 GASLELLSYFLSNI*NFSSSRPCLKNIMMVFAYHQSLYIPSWQPCHHN 451 GA F+ N+ S+S K + Y IP+W P +H+ Sbjct: 301 GADFPFNFAFIKNVSRDSNSSDFKKLVDNWMTYMPPSGIPNWVPGNHD 348 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -3 Query: 294 CRISCHRRRMFRLAVVQDYVNSALDGRVRALVSLFSRR 181 C C RM YVNSAL+ + + +L RR Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRR 390 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -3 Query: 294 CRISCHRRRMFRLAVVQDYVNSALDGRVRALVSLFSRR 181 C C RM YVNSAL+ + + +L RR Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRR 390 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 439 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 341 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 439 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 341 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -3 Query: 294 CRISCHRRRMFRLAVVQDYVNSALDGRVRALVSLFSRR 181 C C RM YVNSAL+ + + +L RR Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRR 390 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = -1 Query: 101 NFIL*VSENISSPVIMSL*IFILMDWRRLKIIK 3 +F+L VS I++ V + IF+ + W + ++++ Sbjct: 230 SFLLYVSGFITTEVAGTYAIFLYISWHQKELVR 262 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,873 Number of Sequences: 438 Number of extensions: 3842 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -