BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30788 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 26 1.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 5.1 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 106 PELYCEICKTSMTCSEQMT--MHLNGKRHLTKEKQHILKMMK 225 P+ YC+ C T +T H G++H K + K M+ Sbjct: 2 PKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWME 43 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 571 LPSCRFRCPN 542 LPSCR CPN Sbjct: 101 LPSCRLPCPN 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,810 Number of Sequences: 2352 Number of extensions: 8229 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -