BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30783 (319 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48410| Best HMM Match : Lig_chan (HMM E-Value=3.5e-05) 26 5.8 SB_1815| Best HMM Match : Lig_chan (HMM E-Value=1.4) 26 5.8 >SB_48410| Best HMM Match : Lig_chan (HMM E-Value=3.5e-05) Length = 1084 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 86 IQLICYKLVYILFSIKLCFLHSHGFLFSNHQEE 184 + ++CYK VY + S K C L +FS+ ++ Sbjct: 360 LDVLCYKSVYEVESSKECILSHMCTMFSHEMDD 392 >SB_1815| Best HMM Match : Lig_chan (HMM E-Value=1.4) Length = 698 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 86 IQLICYKLVYILFSIKLCFLHSHGFLFSNHQEE 184 + ++CYK VY + S K C L +FS+ ++ Sbjct: 32 LDVLCYKSVYEVESSKECILSHMCTMFSHEMDD 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,096,428 Number of Sequences: 59808 Number of extensions: 101399 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 413004273 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -