BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30783 (319 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42844-8|AAB53820.1| 400|Caenorhabditis elegans Hypothetical pr... 33 0.045 U64853-5|AAB04978.2| 460|Caenorhabditis elegans Hypothetical pr... 26 5.1 Z81537-9|CAB04376.2| 673|Caenorhabditis elegans Hypothetical pr... 26 6.8 Z81537-5|CAB04381.2| 673|Caenorhabditis elegans Hypothetical pr... 26 6.8 U88172-6|AAB42261.1| 310|Caenorhabditis elegans Hypothetical pr... 26 6.8 AF067217-1|AAY55828.1| 191|Caenorhabditis elegans Hypothetical ... 26 6.8 Z70752-4|CAA94756.2| 363|Caenorhabditis elegans Hypothetical pr... 25 8.9 >U42844-8|AAB53820.1| 400|Caenorhabditis elegans Hypothetical protein C08A9.8 protein. Length = 400 Score = 33.1 bits (72), Expect = 0.045 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = +2 Query: 29 GSQCKRKSIYENKNVKFK*IQLICYKLVYILFSIKLC---FLHSHGFLFSNHQEESL 190 G+ CK Y NK +K K ++L Y Y +FS K FL+ H F F H+ ESL Sbjct: 86 GNNCKHFIQYPNKQIKTKLLKLKSYSNKYKMFSRKKIYRKFLNIHCFKF--HKFESL 140 >U64853-5|AAB04978.2| 460|Caenorhabditis elegans Hypothetical protein K11G9.5 protein. Length = 460 Score = 26.2 bits (55), Expect = 5.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 81 SKYN*FAIN*FIFCLV*NCVFYIHMDFCFLIIKKNLCF 194 +KY + CLV C Y+ M+F F+ +K ++ F Sbjct: 6 NKYRVLVVFIGFLCLVSVCSNYVVMNFTFICMKNDMSF 43 >Z81537-9|CAB04376.2| 673|Caenorhabditis elegans Hypothetical protein F41D3.10 protein. Length = 673 Score = 25.8 bits (54), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 199 IVLNLLQSNHEHFKFGP 249 I+LN+ N EHFK GP Sbjct: 368 ILLNVFLINKEHFKMGP 384 >Z81537-5|CAB04381.2| 673|Caenorhabditis elegans Hypothetical protein F41D3.5 protein. Length = 673 Score = 25.8 bits (54), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 199 IVLNLLQSNHEHFKFGP 249 I+LN+ N EHFK GP Sbjct: 368 ILLNVFLINKEHFKMGP 384 >U88172-6|AAB42261.1| 310|Caenorhabditis elegans Hypothetical protein ZK354.9 protein. Length = 310 Score = 25.8 bits (54), Expect = 6.8 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +2 Query: 98 CYKLVYILFSIKLCFLHSHGFLFSNHQEESLFSRLF*IY 214 C + + +LF+ K+ F +H F+ + E SL ++++ Y Sbjct: 84 CLETILLLFAYKVIF-PNHFFMLRGNHECSLINKIYGFY 121 >AF067217-1|AAY55828.1| 191|Caenorhabditis elegans Hypothetical protein F56A6.5 protein. Length = 191 Score = 25.8 bits (54), Expect = 6.8 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +2 Query: 5 DRCKSQMKGSQC---KRKSIYENKNV 73 DRC+ Q+ +C KR++ +E KNV Sbjct: 31 DRCRLQLLNKRCPHCKRENAFERKNV 56 >Z70752-4|CAA94756.2| 363|Caenorhabditis elegans Hypothetical protein F25B3.4 protein. Length = 363 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 98 CYKLVYILFSIKLCFLHSHGFLFSNHQEESLFSRLF*IY 214 C + + +LF+ K+ F +H F+ + E SL +R + Y Sbjct: 149 CLETILLLFAYKVIF-PNHFFMLRGNHECSLINRQYGFY 186 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,552,583 Number of Sequences: 27780 Number of extensions: 86587 Number of successful extensions: 174 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 366105812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -