BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30782 (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 0.55 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 23 6.8 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 23 6.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 9.0 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 22 9.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 0.55 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 3 LHIFYFIFQLENGAAAYIQATTVVQHKIKSKKN 101 +H+ +F+ LEN + TTV+ H + ++ N Sbjct: 934 IHVRFFMLSLENKPHVFDCYTTVIPHTVLTQYN 966 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 22.6 bits (46), Expect = 6.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 352 ALRTFTIFCSSMRKALTMRCLTHLWQRTPP*TRSL 248 ALRT CS ++K ++ +T L+ P R+L Sbjct: 74 ALRTKCARCSPIQKENALKIITRLYYDYPDQYRAL 108 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 22.6 bits (46), Expect = 6.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 352 ALRTFTIFCSSMRKALTMRCLTHLWQRTPP*TRSL 248 ALRT CS ++K ++ +T L+ P R+L Sbjct: 74 ALRTKCARCSPIQKENALKIITRLYYDYPDQYRAL 108 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.2 bits (45), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 255 RVYGGVLCHKCVKQ 296 ++Y GVL KC+K+ Sbjct: 290 QIYMGVLTQKCIKE 303 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 219 FSRSSWLDTTEFALALTTP 163 FSRS W D+ F +T P Sbjct: 293 FSRSIWADSIVFDSIITDP 311 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,260 Number of Sequences: 2352 Number of extensions: 9233 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -