BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30782 (459 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) iden... 80 6e-16 At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) simi... 78 2e-15 At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) simi... 78 3e-15 At3g56240.1 68416.m06250 copper homeostasis factor / copper chap... 28 3.5 At1g48740.1 68414.m05454 expressed protein 28 3.5 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 27 6.1 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 27 6.1 At1g54500.1 68414.m06216 rubredoxin family protein similar to SP... 27 8.1 At1g28320.1 68414.m03475 protease-related similar to Protease de... 27 8.1 >At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) identical to GB:Q42351, location of EST 105E2T7, gb|T22624 Length = 120 Score = 80.2 bits (189), Expect = 6e-16 Identities = 41/75 (54%), Positives = 51/75 (68%), Gaps = 2/75 (2%) Frame = +1 Query: 37 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 216 MVQRL +R R SY TKSNQ RIV+TPGG+LVYQ KK P+C +++GI RP+ Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS 60 Query: 217 E--RSRLCYRKKTVN 255 E RSRL ++TVN Sbjct: 61 EYKRSRLSRNRRTVN 75 Score = 46.0 bits (104), Expect = 1e-05 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +3 Query: 255 RVYGGVLCHKCVKQRIVRAFLIEEQKIVK 341 R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 76 RAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) similar to SP:Q42351 from [Arabidopsis thaliana] Length = 119 Score = 78.2 bits (184), Expect = 2e-15 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Frame = +1 Query: 37 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 216 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ KK P+C +++GI RP Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT 60 Query: 217 E--RSRLCYRKKTVN 255 E RSRL ++TVN Sbjct: 61 EYKRSRLSRNRRTVN 75 Score = 46.0 bits (104), Expect = 1e-05 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +3 Query: 255 RVYGGVLCHKCVKQRIVRAFLIEEQKIVK 341 R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 76 RAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) similar to 60S ribosomal protein L34 GB:P41098 [Nicotiana tabacum] Length = 120 Score = 77.8 bits (183), Expect = 3e-15 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Frame = +1 Query: 37 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 216 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ K P+C +++GI RPA Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA 60 Query: 217 E--RSRLCYRKKTVN 255 E RSRL ++TVN Sbjct: 61 EYKRSRLARNERTVN 75 Score = 45.6 bits (103), Expect = 2e-05 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +3 Query: 255 RVYGGVLCHKCVKQRIVRAFLIEEQKIVK 341 R YGGVL V++RIVRAFL+EEQKIVK Sbjct: 76 RAYGGVLSGVAVRERIVRAFLVEEQKIVK 104 >At3g56240.1 68416.m06250 copper homeostasis factor / copper chaperone (CCH) (ATX1) identical to gi:3168840 Pfam profile PF00403: Heavy-metal-associated domain Length = 121 Score = 27.9 bits (59), Expect = 3.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 90 SKKNSKDTGWPLGLSVCKKAQEDPKVWSVQE 182 SK K + WP+ KA+ DPKV +V E Sbjct: 58 SKTGKKTSYWPVEAEAEPKAEADPKVETVTE 88 >At1g48740.1 68414.m05454 expressed protein Length = 393 Score = 27.9 bits (59), Expect = 3.5 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +1 Query: 52 TFRRRLSYNTKSNQRRIVRTP-GGRLVYQ 135 +FR+ +S NTK + RRI+ P G LV+Q Sbjct: 130 SFRKAISENTKESFRRIISEPFPGVLVFQ 158 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 27.1 bits (57), Expect = 6.1 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -1 Query: 207 SWLDTTEFALALTTPWDLLGLFYILINQAATRCPYY 100 SWLD A L +D++G+ ++++ T+C + Sbjct: 5055 SWLDEINSATDLQEAFDIVGVLADVLSEGVTQCDQF 5090 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.1 bits (57), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 227 RERSAGLAGWIPRSLLLH*PHLGIFL 150 +ERS + GW P+ L+L P +G FL Sbjct: 347 KERSLLIKGWSPQMLILSHPAVGGFL 372 >At1g54500.1 68414.m06216 rubredoxin family protein similar to SP|P00270 Rubredoxin (Rd) {Desulfovibrio gigas}; contains Pfam profile PF00301: Rubredoxin Length = 195 Score = 26.6 bits (56), Expect = 8.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 282 YGRGHHHKHVHCFLTVAKTGTFSR 211 YG+ HH H H F+T++ SR Sbjct: 29 YGKKLHHLHHHIFITISYPSHHSR 52 >At1g28320.1 68414.m03475 protease-related similar to Protease degS [Precursor] (SP:P44947) [Haemophilus influenzae]; similar to DegP protease precursor (GI:2565436) [Arabidopsis thaliana] Length = 709 Score = 26.6 bits (56), Expect = 8.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 60 ATTVVQHKIKSKKNSKDTGWPLGLSVCKKA 149 ++ +Q I++ SKD+GW +G S+ A Sbjct: 141 SSAALQSLIEASSGSKDSGWDIGWSLVSAA 170 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,701,074 Number of Sequences: 28952 Number of extensions: 177808 Number of successful extensions: 485 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -