BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30781 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 24 1.4 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 24 1.4 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 24 1.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 1.9 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 2.5 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 23 2.5 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 23 2.5 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 7.7 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 447 EYHLERL---RRRADTDHSVVLSIKII*QWF 364 E+H R RRR + H++VLS + I WF Sbjct: 251 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 281 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 447 EYHLERL---RRRADTDHSVVLSIKII*QWF 364 E+H R RRR + H++VLS + I WF Sbjct: 251 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 281 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 447 EYHLERL---RRRADTDHSVVLSIKII*QWF 364 E+H R RRR + H++VLS + I WF Sbjct: 251 EFHYNRYLTRRRRIEIAHTLVLSERQIKIWF 281 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = -2 Query: 297 VGSRSFHTM*WHPICAITELAISAKKNKDIFPIV 196 +G + + ++ WH + + +SA KD P++ Sbjct: 465 MGIQPYDSLLWHTWMPVMRICVSAWNPKDCDPLI 498 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 495 HQHRFLLHNKYDSRKSKTY 551 HQH FL NKY Y Sbjct: 126 HQHHFLHENKYQLEVDSGY 144 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 495 HQHRFLLHNKYDSRKSKTY 551 HQH FL NKY Y Sbjct: 126 HQHHFLHENKYQLEVDSGY 144 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 495 HQHRFLLHNKYDSRKSKTY 551 HQH FL NKY Y Sbjct: 126 HQHHFLHENKYQLEVDSGY 144 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 355 PSPEPLSNYLDAQYYGVISIGTPP 426 P P P+ + A+Y+ + G PP Sbjct: 163 PPPPPVYTHHYARYHPYPNFGVPP 186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,418 Number of Sequences: 336 Number of extensions: 4043 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -