BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30780 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) 61 6e-10 SB_8022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40367| Best HMM Match : ECH (HMM E-Value=3.3) 29 1.7 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 29 1.7 SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_44881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) Length = 92 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +1 Query: 256 GVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 402 G PSHF S S+AR L+ LE +KLVEK GGR +T+QG+RD+DRI Sbjct: 40 GSAPSHFEVGSASVARSVLKGLEQIKLVEKASTGGRNITSQGQRDMDRI 88 Score = 58.8 bits (136), Expect = 2e-09 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = +2 Query: 74 TGKVKVPEHMDLVKTARFKELAPYDPDWFYVR 169 +G +K+P+ +DLVKT +FKELAPYDPDW+Y+R Sbjct: 2 SGNLKIPDWVDLVKTGKFKELAPYDPDWYYIR 33 >SB_8022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.9 bits (64), Expect = 1.3 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +2 Query: 14 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMD-LVKTARFKELAPYDPDWFYVRCAAILRH 190 TV V K KT ++VP ++ L T R E+ + W V+C Sbjct: 221 TVNKVTGRKYTKTFVIMSGSNRPMRVPHSLEPLTLTNRVAEVT-FCRSWNAVKCTKYCAL 279 Query: 191 IYIRSPVGVKTVTKIFG 241 IY+ S + + V K+ G Sbjct: 280 IYLHSRLDTQPVNKVIG 296 >SB_40367| Best HMM Match : ECH (HMM E-Value=3.3) Length = 231 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 191 IYIRSPVGVKTVTKIFGGRKRMEL-HLHISAGHQAVLHARLCNRWR 325 +Y S + +K ++ G R ++ + H ++ HQ + LC RWR Sbjct: 32 VYTLSTIHLKREQRLLSGMWRSKIRYRHNTSQHQCCPNKELCTRWR 77 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 237 LVGANVWSYTFTFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 362 L G S T TF ++ C +GF ++G +S+G+WS Sbjct: 11 LNGTKTGSLT-TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 51 >SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 237 LVGANVWSYTFTFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 362 L G S T TF ++ C +GF ++G +S+G+WS Sbjct: 276 LNGTKTGSLT-TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 316 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 243 GANVWSYTFTFLQVIRQYCTQGFAIVGG-IEAC*ESSGRWS 362 G S T TF + C +GF ++G + +C +SSG+WS Sbjct: 104 GTKTGSLT-TFPNKVTFSCDEGFILIGSPLRSC-QSSGKWS 142 >SB_44881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 230 KIFGGRKRMELHLHISAGHQAVLHARLCNRW 322 K FG +KR L+ +A++H LC +W Sbjct: 37 KRFGQKKRKVSRLYFQYAGEALIHDTLCTKW 67 >SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 25 C*TRQDC*NCRCSLKKNGQSQGT*AHGSCKDSSLQRAGSV 144 C QDC + RC +KNG + T A G CK S + ++ Sbjct: 301 CNCMQDCSSSRCFWRKNG-IECTPACGQCKGSDCTNSPAI 339 >SB_29339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 270 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWSHSHHT 377 T+ I C +G+A++G +++G WS S+ T Sbjct: 913 TYSSTINITCDEGYALIGPESRVCQANGTWSGSNVT 948 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,671,551 Number of Sequences: 59808 Number of extensions: 297563 Number of successful extensions: 678 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -