BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30780 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ... 101 4e-22 At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S ... 100 5e-22 At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) simi... 99 8e-22 At4g16095.1 68417.m02440 disease resistance protein-related cont... 29 1.4 At5g45800.1 68418.m05632 leucine-rich repeat transmembrane prote... 29 1.8 At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063... 29 2.4 At5g22940.1 68418.m02682 exostosin family protein contains Pfam ... 27 5.5 At5g16500.1 68418.m01928 protein kinase family protein contains ... 27 7.3 At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 27 9.6 At2g38120.1 68415.m04679 amino acid permease, putative (AUX1) id... 27 9.6 At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase,... 27 9.6 At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase,... 27 9.6 >At5g61170.1 68418.m07674 40S ribosomal protein S19 (RPS19C) 40S ribsomal protein S19, Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 101 bits (241), Expect = 4e-22 Identities = 42/80 (52%), Positives = 59/80 (73%) Frame = +2 Query: 14 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 193 TVKDV + VK AAHLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHEFVKAYAAHLKRSGKIELPLWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 194 YIRSPVGVKTVTKIFGGRKR 253 Y+R +GV +I+GG KR Sbjct: 66 YLRGGLGVGAFRRIYGGSKR 85 Score = 56.4 bits (130), Expect = 1e-08 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = +1 Query: 256 GVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 402 G P HFC+SSG +AR LQ L+ + +V+ GGR +T+ G+RDLD++ Sbjct: 87 GSRPPHFCKSSGGVARHILQQLQTMNIVDLDTKGGRKITSSGQRDLDQV 135 >At5g15520.1 68418.m01817 40S ribosomal protein S19 (RPS19B) 40S RIBOSOMAL PROTEIN S19 - Oryza sativa, SWISSPROT:RS19_ORYSA Length = 143 Score = 100 bits (240), Expect = 5e-22 Identities = 43/80 (53%), Positives = 58/80 (72%) Frame = +2 Query: 14 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 193 TVKDV VK A+HLK++GK+++P D+VKT R KELAPYDPDW+Y+R A++ R I Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPLWTDIVKTGRLKELAPYDPDWYYIRAASMARKI 65 Query: 194 YIRSPVGVKTVTKIFGGRKR 253 Y+R +GV +I+GG KR Sbjct: 66 YLRGGLGVGAFRRIYGGSKR 85 Score = 59.3 bits (137), Expect = 1e-09 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = +1 Query: 256 GVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 402 G P HFC+SSG IAR LQ LE + +VE GGR +T+ G+RDLD++ Sbjct: 87 GSRPPHFCKSSGGIARHILQQLETMSIVELDTKGGRRITSSGQRDLDQV 135 >At3g02080.1 68416.m00173 40S ribosomal protein S19 (RPS19A) similar to 40S ribosomal protein S19 GB:P40978 [Oryza sativa] Length = 143 Score = 99 bits (238), Expect = 8e-22 Identities = 41/80 (51%), Positives = 58/80 (72%) Frame = +2 Query: 14 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 193 TVKDV VK A+HLK++GK+++P D+VKT + KELAPYDPDW+Y+R A++ R + Sbjct: 6 TVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKV 65 Query: 194 YIRSPVGVKTVTKIFGGRKR 253 Y+R +GV +I+GG KR Sbjct: 66 YLRGGLGVGAFRRIYGGSKR 85 Score = 59.3 bits (137), Expect = 1e-09 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = +1 Query: 256 GVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 402 G P HFC+SSG IAR LQ LE + +VE GGR +T+ G+RDLD++ Sbjct: 87 GSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLDQV 135 >At4g16095.1 68417.m02440 disease resistance protein-related contains weak similarity to rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 187 Score = 29.5 bits (63), Expect = 1.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 358 HRPELSQQASMPPTIAKPCVQYCLM 284 H P L Q PP + C++YC M Sbjct: 86 HMPRLPDQHRFPPNLTNICLRYCCM 110 >At5g45800.1 68418.m05632 leucine-rich repeat transmembrane protein kinase, putative Length = 666 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/50 (24%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 59 AHLKKTGKVKVPEHMDLVK-TARFKELAPYDPDWFYVRCAAILRHIYIRS 205 +H + V P D + T F+ ++ ++ WF C+A++ H+ + S Sbjct: 15 SHSDSSSTVSCPNGTDFHQLTTVFRYVSGFNSSWFSSNCSAVITHVVLPS 64 >At1g14300.1 68414.m01695 expressed protein contains Pfam PF04063: Domain of unknown function (DUF383) and PF04064: Domain of unknown function (DUF384) Length = 339 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 274 FCRSSGSIARKALQSLEALKL-VEKVQDGGRILTTQGRRDLDRI 402 FCRSSG A + + ++ + + K +DG ++L RR L +I Sbjct: 143 FCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQI 186 >At5g22940.1 68418.m02682 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 469 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +2 Query: 212 GVKT-VTKIFGGRKRMELHLHISAGHQA 292 GV+T + K FGGR+R L+ H AG+++ Sbjct: 310 GVRTAILKKFGGRRRFYLNRHRFAGYRS 337 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 23 DVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELA 139 +VE D+ V A K+T + + E VKT F+ELA Sbjct: 30 NVEHDEFRPPVVATTKRTEEREPAEQQPPVKTFNFRELA 68 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 269 HISAGHQAVLHARLCNRWRH*SLLRKFRTVVAFSPHKVD 385 HIS G+ V+ A WR+ LR+ + FS H+++ Sbjct: 108 HISYGNSTVVSASYSEHWRN---LRRIGALEIFSAHRLN 143 >At2g38120.1 68415.m04679 amino acid permease, putative (AUX1) identical to AUX1 GI:1531758 from [Arabidopsis thaliana] Length = 485 Score = 26.6 bits (56), Expect = 9.6 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 135 WLRMTL-IGSMCVVLPSFVIFTFAHLLESRLSPRSLVGANVWSYTFTFLQVIRQYCTQGF 311 +L TL + ++ + + V + F L + SL+ N W L +I Q+ T GF Sbjct: 269 YLMATLYVFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNAWRDAAVILMLIHQFITFGF 328 Query: 312 A 314 A Sbjct: 329 A 329 >At1g43620.2 68414.m05008 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.6 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +2 Query: 14 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 190 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 >At1g43620.1 68414.m05007 UDP-glucose:sterol glucosyltransferase, putative similar to UDP-glucose:sterol glucosyltransferase [Arabidopsis thaliana] GI:2462931; contains Pfam profile: PF03033 glycosyltransferase family 28 N-terminal domain Length = 615 Score = 26.6 bits (56), Expect = 9.6 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +2 Query: 14 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRH 190 T+KD EQ IV L +VPE++ LV E P+D W + +C+A++ H Sbjct: 433 TLKDTEQRGIVDRGWGGLGNLA-TEVPENVFLV------EDCPHD--WLFPQCSAVVHH 482 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,024,091 Number of Sequences: 28952 Number of extensions: 198731 Number of successful extensions: 445 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -