BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30776 (304 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X55715-1|CAA39248.1| 243|Homo sapiens protein ( Human Hums3 mRN... 112 2e-25 U14992-1|AAB60338.1| 243|Homo sapiens ribosomal protein S3 prot... 112 2e-25 U14991-1|AAB60337.1| 243|Homo sapiens ribosomal protein S3 prot... 112 2e-25 U14990-1|AAB60336.1| 243|Homo sapiens ribosomal protein S3 prot... 112 2e-25 S42658-1|AAB19349.2| 243|Homo sapiens S3 ribosomal protein prot... 112 2e-25 BC100284-1|AAI00285.1| 243|Homo sapiens ribosomal protein S3 pr... 112 2e-25 BC071917-1|AAH71917.1| 243|Homo sapiens ribosomal protein S3 pr... 112 2e-25 BC034149-1|AAH34149.1| 243|Homo sapiens ribosomal protein S3 pr... 112 2e-25 BC013196-1|AAH13196.1| 242|Homo sapiens Unknown (protein for IM... 112 2e-25 BC003577-1|AAH03577.1| 242|Homo sapiens Unknown (protein for IM... 112 2e-25 BC003137-1|AAH03137.1| 243|Homo sapiens ribosomal protein S3 pr... 112 2e-25 AY791291-1|AAV40835.1| 243|Homo sapiens ribosomal protein S3 pr... 112 2e-25 AK223048-1|BAD96768.1| 243|Homo sapiens ribosomal protein S3 va... 112 2e-25 AF281313-1|AAF82383.1| 158|Homo sapiens ribosomal protein S3 pr... 112 2e-25 AB062288-1|BAB93471.1| 117|Homo sapiens IMR-90 ribosomal protei... 112 2e-25 AB061838-1|BAB79476.1| 243|Homo sapiens ribosomal protein S3 pr... 112 2e-25 BC150501-1|AAI50502.1| 133|Homo sapiens Unknown (protein for IM... 44 7e-05 AK127619-1|BAC87060.1| 237|Homo sapiens protein ( Homo sapiens ... 36 0.031 X75755-1|CAA53383.1| 221|Homo sapiens PR264/SC35 protein. 29 2.0 X62447-1|CAA44307.1| 221|Homo sapiens PR 264 protein. 29 2.0 S95936-1|AAB22049.1| 698|Homo sapiens transferrin protein. 29 2.0 M90104-1|AAA60306.1| 221|Homo sapiens splicing factor protein. 29 2.0 M12530-1|AAA61140.1| 698|Homo sapiens TF protein. 29 2.0 M11372-1|AAA61141.1| 490|Homo sapiens TF protein. 29 2.0 DQ923758-1|ABI97197.1| 698|Homo sapiens transferrin protein. 29 2.0 DQ525716-1|ABF47110.1| 698|Homo sapiens transferrin protein. 29 2.0 BT007250-1|AAP35914.1| 221|Homo sapiens splicing factor, argini... 29 2.0 BC070086-1|AAH70086.1| 221|Homo sapiens splicing factor, argini... 29 2.0 BC059367-1|AAH59367.1| 698|Homo sapiens transferrin protein. 29 2.0 BC001303-1|AAH01303.1| 221|Homo sapiens SFRS2 protein protein. 29 2.0 BC000339-1|AAH00339.1| 221|Homo sapiens SFRS2 protein protein. 29 2.0 AY308797-1|AAP45055.1| 698|Homo sapiens transferrin protein. 29 2.0 AK223252-1|BAD96972.1| 221|Homo sapiens splicing factor, argini... 29 2.0 AK222755-1|BAD96475.1| 698|Homo sapiens transferrin variant pro... 29 2.0 AK092489-1|BAC03903.1| 201|Homo sapiens protein ( Homo sapiens ... 29 2.0 AF288144-1|AAK77664.1| 698|Homo sapiens transferin protein. 29 2.0 CR456437-1|CAG30323.1| 863|Homo sapiens dJ1014D13.2 protein. 29 2.7 BC111855-1|AAI11856.1| 197|Homo sapiens transmembrane protein 5... 29 2.7 BC104444-1|AAI04445.1| 197|Homo sapiens transmembrane protein 5... 29 2.7 BC061908-1|AAH61908.1| 176|Homo sapiens TMEM58 protein protein. 29 2.7 BC009558-1|AAH09558.1| 228|Homo sapiens TMEM58 protein protein. 29 2.7 AL833860-1|CAD38718.1| 657|Homo sapiens hypothetical protein pr... 29 2.7 AL513217-1|CAH72277.1| 197|Homo sapiens transmembrane protein 5... 29 2.7 AL022311-1|CAI18864.1| 863|Homo sapiens protein ( Human DNA seq... 29 2.7 AJ496196-1|CAD42713.1| 863|Homo sapiens molecule interacting wi... 29 2.7 AF072836-1|AAC26860.1| 341|Homo sapiens Sox-like transcriptiona... 29 2.7 AB051455-1|BAB33338.1| 791|Homo sapiens KIAA1668 protein protein. 29 2.7 AL645728-5|CAI22949.1| 228|Homo sapiens chromosome 1 open readi... 29 3.5 AB089939-1|BAD06471.1| 1039|Homo sapiens N-acetylgalactosaminylt... 29 3.5 L27428-1|AAB02291.1| 361|Homo sapiens reverse transcriptase pro... 28 4.7 BC033513-1|AAH33513.1| 265|Homo sapiens Unknown (protein for IM... 28 4.7 X52235-2|CAA36480.1| 712|Homo sapiens protein ( Human DNA for L... 28 6.2 U94836-1|AAB53327.1| 884|Homo sapiens ERPROT 213-21 protein. 28 6.2 U93574-2|AAC51279.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U93572-2|AAC51276.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U93568-2|AAC51269.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U93567-2|AAC51267.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U93565-1|AAC51264.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U93564-2|AAC51263.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U93563-1|AAC51261.1| 1275|Homo sapiens putative p150 protein. 28 6.2 U09116-2|AAB60345.1| 1275|Homo sapiens ORF2 protein. 28 6.2 U05321-1|AAB60375.1| 613|Homo sapiens X-linked PEST-containing ... 28 6.2 U05315-1|AAB60374.1| 598|Homo sapiens X-linked PEST-containing ... 28 6.2 M80343-2|AAB59368.1| 1275|Homo sapiens protein ( Human transposo... 28 6.2 M80340-1|AAA51622.1| 1275|Homo sapiens ORF2 protein. 28 6.2 M69297-3|AAA58464.1| 143|Homo sapiens protein ( Human estrogen ... 28 6.2 M22334-1|AAA88038.1| 641|Homo sapiens unknown protein protein. 28 6.2 M22333-1|AAA88037.1| 1192|Homo sapiens unknown protein protein. 28 6.2 M22332-1|AAA88036.1| 157|Homo sapiens unknown protein protein. 28 6.2 BC104445-1|AAI04446.1| 197|Homo sapiens transmembrane protein 5... 28 6.2 BC021294-1|AAH21294.1| 884|Homo sapiens calcium homeostasis end... 28 6.2 AY358589-1|AAQ88952.1| 197|Homo sapiens PPAG583 protein. 28 6.2 AL157934-1|CAI40762.2| 613|Homo sapiens solute carrier family 1... 28 6.2 AK125113-1|BAC86052.1| 654|Homo sapiens protein ( Homo sapiens ... 28 6.2 AK123395-1|BAC85603.1| 126|Homo sapiens protein ( Homo sapiens ... 28 6.2 AK096400-1|BAC04777.1| 644|Homo sapiens protein ( Homo sapiens ... 28 6.2 AK055521-1|BAB70940.1| 605|Homo sapiens protein ( Homo sapiens ... 28 6.2 AF421375-1|AAL50637.1| 1275|Homo sapiens unknown protein. 28 6.2 AF149422-2|AAD38785.1| 1275|Homo sapiens unknown protein. 28 6.2 AF148856-2|AAD39215.1| 1275|Homo sapiens unknown protein. 28 6.2 AB209730-1|BAD92967.1| 399|Homo sapiens calcium homeostasis end... 28 6.2 AB085789-1|BAC76827.1| 539|Homo sapiens X-linked PEST-containin... 28 6.2 BC122564-1|AAI22565.1| 632|Homo sapiens TBC1 domain family, mem... 27 8.1 AL591849-3|CAI40161.1| 1178|Homo sapiens novel protein protein. 27 8.1 AL391315-4|CAI39548.1| 1178|Homo sapiens novel protein protein. 27 8.1 AK125394-1|BAC86155.1| 133|Homo sapiens protein ( Homo sapiens ... 27 8.1 AK123957-1|BAC85735.1| 632|Homo sapiens protein ( Homo sapiens ... 27 8.1 >X55715-1|CAA39248.1| 243|Homo sapiens protein ( Human Hums3 mRNA for 40S ribosomal protein s3. ). Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >U14992-1|AAB60338.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >U14991-1|AAB60337.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >U14990-1|AAB60336.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >S42658-1|AAB19349.2| 243|Homo sapiens S3 ribosomal protein protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >BC100284-1|AAI00285.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >BC071917-1|AAH71917.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >BC034149-1|AAH34149.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >BC013196-1|AAH13196.1| 242|Homo sapiens Unknown (protein for IMAGE:4347401) protein. Length = 242 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 158 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 217 Query: 182 PLEPTSE 202 P P SE Sbjct: 218 PTTPISE 224 >BC003577-1|AAH03577.1| 242|Homo sapiens Unknown (protein for IMAGE:3544292) protein. Length = 242 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 158 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 217 Query: 182 PLEPTSE 202 P P SE Sbjct: 218 PTTPISE 224 >BC003137-1|AAH03137.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >AY791291-1|AAV40835.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >AK223048-1|BAD96768.1| 243|Homo sapiens ribosomal protein S3 variant protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >AF281313-1|AAF82383.1| 158|Homo sapiens ribosomal protein S3 protein. Length = 158 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 74 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 133 Query: 182 PLEPTSE 202 P P SE Sbjct: 134 PTTPISE 140 >AB062288-1|BAB93471.1| 117|Homo sapiens IMR-90 ribosomal protein S3 protein. Length = 117 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 33 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 92 Query: 182 PLEPTSE 202 P P SE Sbjct: 93 PTTPISE 99 >AB061838-1|BAB79476.1| 243|Homo sapiens ribosomal protein S3 protein. Length = 243 Score = 112 bits (269), Expect = 2e-25 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPV 181 HSGDP N YV+TA RHVLLRQGVLGIKVKIMLPWD GK GPKKP PDH+ + EPKDE + Sbjct: 159 HSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEIL 218 Query: 182 PLEPTSE 202 P P SE Sbjct: 219 PTTPISE 225 >BC150501-1|AAI50502.1| 133|Homo sapiens Unknown (protein for IMAGE:40134452) protein. Length = 133 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 HSGDPCNDYVNTATRHVLLRQGVLGIKVKI 91 HSGDP N YV+TA RHVLLRQGV V + Sbjct: 103 HSGDPVNYYVDTAVRHVLLRQGVWDTSVHL 132 >AK127619-1|BAC87060.1| 237|Homo sapiens protein ( Homo sapiens cDNA FLJ45717 fis, clone FELNG2001613. ). Length = 237 Score = 35.5 bits (78), Expect = 0.031 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 49 CASQTRSTRNQGQNHVAVGPARQERPEEATTRPHPGNRAQGRARAPR 189 CAS RS R Q Q P P A RP PG+ APR Sbjct: 114 CASSDRSLREQKQRRAGPDPTPSPAPPPAGPRPSPGSLGPSAPAAPR 160 >X75755-1|CAA53383.1| 221|Homo sapiens PR264/SC35 protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >X62447-1|CAA44307.1| 221|Homo sapiens PR 264 protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >S95936-1|AAB22049.1| 698|Homo sapiens transferrin protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >M90104-1|AAA60306.1| 221|Homo sapiens splicing factor protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >M12530-1|AAA61140.1| 698|Homo sapiens TF protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >M11372-1|AAA61141.1| 490|Homo sapiens TF protein. Length = 490 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 45 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 85 >DQ923758-1|ABI97197.1| 698|Homo sapiens transferrin protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >DQ525716-1|ABF47110.1| 698|Homo sapiens transferrin protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >BT007250-1|AAP35914.1| 221|Homo sapiens splicing factor, arginine/serine-rich 2 protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >BC070086-1|AAH70086.1| 221|Homo sapiens splicing factor, arginine/serine-rich 2 protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >BC059367-1|AAH59367.1| 698|Homo sapiens transferrin protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >BC001303-1|AAH01303.1| 221|Homo sapiens SFRS2 protein protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >BC000339-1|AAH00339.1| 221|Homo sapiens SFRS2 protein protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >AY308797-1|AAP45055.1| 698|Homo sapiens transferrin protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >AK223252-1|BAD96972.1| 221|Homo sapiens splicing factor, arginine/serine-rich 2 variant protein. Length = 221 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 151 SRTRSRSRSTSKSRSARRSKSKSSS 175 >AK222755-1|BAD96475.1| 698|Homo sapiens transferrin variant protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >AK092489-1|BAC03903.1| 201|Homo sapiens protein ( Homo sapiens cDNA FLJ35170 fis, clone PLACE6012942, highly similar to SPLICING FACTOR, ARGININE/SERINE-RICH 2. ). Length = 201 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = +3 Query: 78 SRSKSCCRGTSKARTARRSHNQTTS 152 SR++S R TSK+R+ARRS ++++S Sbjct: 131 SRTRSRSRSTSKSRSARRSKSKSSS 155 >AF288144-1|AAK77664.1| 698|Homo sapiens transferin protein. Length = 698 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 268 IVLYPSDSGDRLRQRRGREGAHFA-GRLEGHGLVLGLCYQD 149 + + DSG ++ Q RG++ H GR G + +GL Y D Sbjct: 117 VAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCD 157 >CR456437-1|CAG30323.1| 863|Homo sapiens dJ1014D13.2 protein. Length = 863 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 98 PWDQQGKNGPKKPQPDHILV-TEPKDEPVPLEPTS 199 P +G P+K P LV EPK +P PL P+S Sbjct: 356 PKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSS 390 >BC111855-1|AAI11856.1| 197|Homo sapiens transmembrane protein 58 protein. Length = 197 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP I P P P P Sbjct: 134 GIPVQPVYPYPQDPKAGPAPPQPGFIY---PPSGPAPQYP 170 >BC104444-1|AAI04445.1| 197|Homo sapiens transmembrane protein 58 protein. Length = 197 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP I P P P P Sbjct: 134 GIPVQPVYPYPQDPKAGPAPPQPGFIY---PPSGPAPQYP 170 >BC061908-1|AAH61908.1| 176|Homo sapiens TMEM58 protein protein. Length = 176 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP I P P P P Sbjct: 113 GIPVQPVYPYPQDPKAGPAPPQPGFIY---PPSGPAPQYP 149 >BC009558-1|AAH09558.1| 228|Homo sapiens TMEM58 protein protein. Length = 228 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP I P P P P Sbjct: 165 GIPVQPVYPYPQDPKAGPAPPQPGFIY---PPSGPAPQYP 201 >AL833860-1|CAD38718.1| 657|Homo sapiens hypothetical protein protein. Length = 657 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 98 PWDQQGKNGPKKPQPDHILV-TEPKDEPVPLEPTS 199 P +G P+K P LV EPK +P PL P+S Sbjct: 150 PKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSS 184 >AL513217-1|CAH72277.1| 197|Homo sapiens transmembrane protein 58 protein. Length = 197 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP I P P P P Sbjct: 134 GIPVQPVYPYPQDPKAGPAPPQPGFIY---PPSGPAPQYP 170 >AL022311-1|CAI18864.1| 863|Homo sapiens protein ( Human DNA sequence from clone RP5-1014D13 on chromosome 22q13.1-13.2. ). Length = 863 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 98 PWDQQGKNGPKKPQPDHILV-TEPKDEPVPLEPTS 199 P +G P+K P LV EPK +P PL P+S Sbjct: 356 PKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSS 390 >AJ496196-1|CAD42713.1| 863|Homo sapiens molecule interacting with Rab13 protein. Length = 863 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 98 PWDQQGKNGPKKPQPDHILV-TEPKDEPVPLEPTS 199 P +G P+K P LV EPK +P PL P+S Sbjct: 356 PKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSS 390 >AF072836-1|AAC26860.1| 341|Homo sapiens Sox-like transcriptional factor protein. Length = 341 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 121 RPEEATTRPHPGNRAQGRARAP 186 RP RPH GN GR RAP Sbjct: 194 RPAREAHRPHQGNPGPGRQRAP 215 >AB051455-1|BAB33338.1| 791|Homo sapiens KIAA1668 protein protein. Length = 791 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 98 PWDQQGKNGPKKPQPDHILV-TEPKDEPVPLEPTS 199 P +G P+K P LV EPK +P PL P+S Sbjct: 284 PKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSS 318 >AL645728-5|CAI22949.1| 228|Homo sapiens chromosome 1 open reading frame 70 protein. Length = 228 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 191 ARGARARPWA-LLPGCGLVVASSGRSCL 111 A G +PWA ++ GCG SSGR CL Sbjct: 198 AGGTGQQPWAQVVRGCGRPGESSGRCCL 225 >AB089939-1|BAD06471.1| 1039|Homo sapiens N-acetylgalactosaminyltransferase protein. Length = 1039 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 115 QERPEEATTRPHPGNRAQGRARAPRA 192 Q P+ TR PG RA RA APRA Sbjct: 520 QPPPKVYVTRVRPGQRASPRAPAPRA 545 >L27428-1|AAB02291.1| 361|Homo sapiens reverse transcriptase protein. Length = 361 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCWSHGNMILTL 79 R W GCG G L CW + ++ L Sbjct: 215 RCWRGCGEIGTLLHCWWNCKLVQPL 239 >BC033513-1|AAH33513.1| 265|Homo sapiens Unknown (protein for IMAGE:5172161) protein. Length = 265 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/48 (41%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 55 SQTRSTRNQGQNHVAVGPARQ-ERPEEATTRPHPGNRAQGRARAPRAD 195 S T S R++G PA+Q P A TRP PG+R G AR D Sbjct: 80 SLTDSQRDEGHLDEERQPAQQVHEPHGAPTRPLPGHR-DGPARFGSGD 126 >X52235-2|CAA36480.1| 712|Homo sapiens protein ( Human DNA for LINE-1 transposable element ORFI and II. ). Length = 712 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 566 RCWRGCGEIGTLLHCW 581 >U94836-1|AAB53327.1| 884|Homo sapiens ERPROT 213-21 protein. Length = 884 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 57 SDKEY*ESRSKSCCRGTSKARTARRSHNQTT 149 S Y SRS+SC R S++R+ RS ++++ Sbjct: 728 SSGSYSRSRSRSCSRSYSRSRSRSRSRSRSS 758 >U93574-2|AAC51279.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U93572-2|AAC51276.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U93568-2|AAC51269.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U93567-2|AAC51267.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U93565-1|AAC51264.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U93564-2|AAC51263.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U93563-1|AAC51261.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U09116-2|AAB60345.1| 1275|Homo sapiens ORF2 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >U05321-1|AAB60375.1| 613|Homo sapiens X-linked PEST-containing transporter protein. Length = 613 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +2 Query: 98 PW---DQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 PW DQ+ + P+P+ EP+ EPVP+ P Sbjct: 88 PWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPP 122 >U05315-1|AAB60374.1| 598|Homo sapiens X-linked PEST-containing transporter protein. Length = 598 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +2 Query: 98 PW---DQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 PW DQ+ + P+P+ EP+ EPVP+ P Sbjct: 73 PWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPP 107 >M80343-2|AAB59368.1| 1275|Homo sapiens protein ( Human transposon L1.2. ). Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >M80340-1|AAA51622.1| 1275|Homo sapiens ORF2 protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >M69297-3|AAA58464.1| 143|Homo sapiens protein ( Human estrogen receptor-related protein (variant ER from breast cancer) mRNA, complete cds. ). Length = 143 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 54 RCWRGCGEIGTLLHCW 69 >M22334-1|AAA88038.1| 641|Homo sapiens unknown protein protein. Length = 641 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 495 RCWRGCGEIGTLLHCW 510 >M22333-1|AAA88037.1| 1192|Homo sapiens unknown protein protein. Length = 1192 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1046 RCWRGCGEIGTLLHCW 1061 >M22332-1|AAA88036.1| 157|Homo sapiens unknown protein protein. Length = 157 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 11 RCWRGCGEIGTLLHCW 26 >BC104445-1|AAI04446.1| 197|Homo sapiens transmembrane protein 58 protein. Length = 197 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP + P P P P Sbjct: 134 GIPVQPVYPYPQDPKAGPAPPQPGFMY---PPSGPAPQYP 170 >BC021294-1|AAH21294.1| 884|Homo sapiens calcium homeostasis endoplasmic reticulum protein protein. Length = 884 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 57 SDKEY*ESRSKSCCRGTSKARTARRSHNQTT 149 S Y SRS+SC R S++R+ RS ++++ Sbjct: 728 SSGSYSRSRSRSCSRSYSRSRSRSRSRSRSS 758 >AY358589-1|AAQ88952.1| 197|Homo sapiens PPAG583 protein. Length = 197 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 74 GIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 GI V+ + P+ Q K GP PQP + P P P P Sbjct: 134 GIPVQPVYPYPQDPKAGPAPPQPGFMY---PPSGPAPQYP 170 >AL157934-1|CAI40762.2| 613|Homo sapiens solute carrier family 16, member 2 (monocarboxylic acid transporter 8) protein. Length = 613 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +2 Query: 98 PW---DQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 PW DQ+ + P+P+ EP+ EPVP+ P Sbjct: 88 PWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPP 122 >AK125113-1|BAC86052.1| 654|Homo sapiens protein ( Homo sapiens cDNA FLJ43123 fis, clone CTONG3003972. ). Length = 654 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 43 QTCASQTRSTRNQGQNHVAVGPARQERPEEATTRPHPGNRAQGRARAPRAD 195 +T Q + G+ + R+ R ++ +RPHP + A+ +A P+ D Sbjct: 359 ETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHP-STAESKAPTPKFD 408 >AK123395-1|BAC85603.1| 126|Homo sapiens protein ( Homo sapiens cDNA FLJ41401 fis, clone BRCOC2019934. ). Length = 126 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 20 RCWRGCGEIGTLLHCW 35 >AK096400-1|BAC04777.1| 644|Homo sapiens protein ( Homo sapiens cDNA FLJ39081 fis, clone NT2RP7018340. ). Length = 644 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 527 RCWRGCGEIGTLLHCW 542 >AK055521-1|BAB70940.1| 605|Homo sapiens protein ( Homo sapiens cDNA FLJ30959 fis, clone HCASM2000307. ). Length = 605 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 43 QTCASQTRSTRNQGQNHVAVGPARQERPEEATTRPHPGNRAQGRARAPRAD 195 +T Q + G+ + R+ R ++ +RPHP + A+ +A P+ D Sbjct: 330 ETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHP-STAESKAPTPKFD 379 >AF421375-1|AAL50637.1| 1275|Homo sapiens unknown protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >AF149422-2|AAD38785.1| 1275|Homo sapiens unknown protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >AF148856-2|AAD39215.1| 1275|Homo sapiens unknown protein. Length = 1275 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 1129 RCWRGCGEIGTLLHCW 1144 >AB209730-1|BAD92967.1| 399|Homo sapiens calcium homeostasis endoplasmic reticulum protein variant protein. Length = 399 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 57 SDKEY*ESRSKSCCRGTSKARTARRSHNQTT 149 S Y SRS+SC R S++R+ RS ++++ Sbjct: 243 SSGSYSRSRSRSCSRSYSRSRSRSRSRSRSS 273 >AB085789-1|BAC76827.1| 539|Homo sapiens X-linked PEST-containing transporter protein. Length = 539 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +2 Query: 98 PW---DQQGKNGPKKPQPDHILVTEPKDEPVPLEP 193 PW DQ+ + P+P+ EP+ EPVP+ P Sbjct: 14 PWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPP 48 >BC122564-1|AAI22565.1| 632|Homo sapiens TBC1 domain family, member 8B (with GRAM domain) protein. Length = 632 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 14 PCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGK 118 PC ++ +T + +LG ++K+++ WD+ K Sbjct: 173 PCQGWLYLSTNFLSFYSFLLGSEIKLIISWDEVSK 207 >AL591849-3|CAI40161.1| 1178|Homo sapiens novel protein protein. Length = 1178 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 14 PCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGK 118 PC ++ +T + +LG ++K+++ WD+ K Sbjct: 231 PCQGWLYLSTNFLSFYSFLLGSEIKLIISWDEVSK 265 >AL391315-4|CAI39548.1| 1178|Homo sapiens novel protein protein. Length = 1178 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 14 PCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGK 118 PC ++ +T + +LG ++K+++ WD+ K Sbjct: 231 PCQGWLYLSTNFLSFYSFLLGSEIKLIISWDEVSK 265 >AK125394-1|BAC86155.1| 133|Homo sapiens protein ( Homo sapiens cDNA FLJ43404 fis, clone OCBBF2017516. ). Length = 133 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 153 RMWSGCGFFGPFLPCW 106 R W GCG G L CW Sbjct: 54 RCWRGCGEVGTLLHCW 69 >AK123957-1|BAC85735.1| 632|Homo sapiens protein ( Homo sapiens cDNA FLJ41963 fis, clone PUAEN2006328, moderately similar to Homo sapiens TBC1 domain family, member 8 (with GRAM ). Length = 632 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 14 PCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGK 118 PC ++ +T + +LG ++K+++ WD+ K Sbjct: 173 PCQGWLYLSTNFLSFYSFLLGSEIKLIISWDEVSK 207 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,836,540 Number of Sequences: 237096 Number of extensions: 711562 Number of successful extensions: 3111 Number of sequences better than 10.0: 87 Number of HSP's better than 10.0 without gapping: 2937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3110 length of database: 76,859,062 effective HSP length: 77 effective length of database: 58,602,670 effective search space used: 1347861410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -