BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30775 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22714| Best HMM Match : TPR_2 (HMM E-Value=1.2e-17) 81 1e-15 SB_35701| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 47 2e-05 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_54763| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_50152| Best HMM Match : TPR_1 (HMM E-Value=0.0019) 44 1e-04 SB_19825| Best HMM Match : TPR_2 (HMM E-Value=4.8e-30) 41 0.001 SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) 41 0.001 SB_44774| Best HMM Match : TPR_2 (HMM E-Value=6.3e-15) 40 0.002 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 39 0.004 SB_42049| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) 39 0.005 SB_21064| Best HMM Match : TPR_2 (HMM E-Value=3.5e-09) 38 0.009 SB_8404| Best HMM Match : TPR_1 (HMM E-Value=0) 37 0.022 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 36 0.029 SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_13361| Best HMM Match : TPR_2 (HMM E-Value=0.0021) 36 0.029 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 36 0.050 SB_44772| Best HMM Match : TPR_2 (HMM E-Value=0) 34 0.15 SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_17634| Best HMM Match : TPR_2 (HMM E-Value=0.06) 32 0.62 SB_58067| Best HMM Match : TPR_2 (HMM E-Value=0) 32 0.62 SB_43858| Best HMM Match : TPR_2 (HMM E-Value=0.0013) 32 0.62 SB_35100| Best HMM Match : TPR_2 (HMM E-Value=0.0013) 32 0.62 SB_23911| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_6794| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_39326| Best HMM Match : TPR_2 (HMM E-Value=3.5e-05) 31 0.81 SB_37264| Best HMM Match : Complex1_LYR (HMM E-Value=4.2) 31 1.1 SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) 31 1.1 SB_22290| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_42713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 30 2.5 SB_31762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_31526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_53163| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_31240| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_54822| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_48397| Best HMM Match : TPR_2 (HMM E-Value=6.6e-26) 28 7.6 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.6 >SB_22714| Best HMM Match : TPR_2 (HMM E-Value=1.2e-17) Length = 455 Score = 80.6 bits (190), Expect = 1e-15 Identities = 37/87 (42%), Positives = 58/87 (66%) Frame = +1 Query: 172 LH*GDKFGRKRQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAF 351 L+ G++ +++Q I+K LK +++E I D KAL+I+P DPKALFRRSQAF Sbjct: 38 LYSGNEKDKEKQKEKAVIYKNRAACQLKLEKYEAAIKDATKALDIVPNDPKALFRRSQAF 97 Query: 352 ECLERFEEAYRDAKTIFTVDPTNKAVQ 432 E R EEA++DA+T+ ++P ++ V+ Sbjct: 98 EATGRLEEAFKDARTLSHLEPKSERVR 124 Score = 31.9 bits (69), Expect = 0.62 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRD------LATYLKNRAAAYLR 256 + A K +GN FK+ +Y+ A++ Y A+ L +D A KNRAA L+ Sbjct: 7 KSAVEIKEEGNKYFKAGDYEAALSSYAAALKLYSGNEKDKEKQKEKAVIYKNRAACQLK 65 >SB_35701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/59 (44%), Positives = 34/59 (57%) Frame = +2 Query: 80 YTMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 Y + +++EAE K K N FK NY AITFYT+AI L D+ Y NR+ YL+ Sbjct: 179 YVLSLEKEAEDLKLKANGYFKEGNYNSAITFYTQAIEL----KADVPAYYGNRSFCYLK 233 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/79 (24%), Positives = 43/79 (54%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 LKT+ + ++D +KA+++ + K +RR+ A L +F+ + +D + + P++K Sbjct: 232 LKTEYYGLALADANKAIQLDRKYIKGYYRRATANMALGKFKLSLKDYEMVVKFHPSDKDA 291 Query: 430 QPILSRLHTVVQERARQNA 486 + + +VQ +A + A Sbjct: 292 KAKYTECKKIVQRQAFEKA 310 >SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = +2 Query: 86 MVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLA-EKGSRDLATYLKNRAAAY 250 M E+A+ K KGN FK Y++AI YT+AI L + +DL+T+ +NRAAAY Sbjct: 135 MTPSEQAQVAKLKGNKYFKGCKYEQAIKCYTEAIELCPPENKQDLSTFYQNRAAAY 190 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTI 399 +FE V+ + KALE+ + KAL RR++A E LER +E +D + Sbjct: 195 QFENVVEEATKALELNSKYTKALMRRARALEKLERKQECLQDLTAV 240 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 47.2 bits (107), Expect = 2e-05 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 12/98 (12%) Frame = +1 Query: 214 PCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEA----- 378 PC + S LK E+ I DC++AL++ KALFRR QA E ++ +EEA Sbjct: 368 PC--YLNSAACKLKLAEYPSAIEDCNEALKLDANSAKALFRRGQANEHMKDYEEAMLQTV 425 Query: 379 ----YRDAK-TIFTVDPTNKAVQPI--LSRLHTVVQER 471 + DAK T++ DP + V L+ L T + ER Sbjct: 426 SDSNHSDAKSTLYICDPAGENVPNAFHLNLLKTTLSER 463 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/61 (37%), Positives = 35/61 (57%) Frame = +2 Query: 92 VQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPKNSK 271 +Q++A ++ KGNDA K E +QEA+ +YTK I L + R NRA +L+ K Sbjct: 860 LQKKANDFREKGNDAVKREEFQEALDWYTKGIELTKTDHR----LFSNRALCHLKLNKPK 915 Query: 272 K 274 + Sbjct: 916 E 916 >SB_54763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1190 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/83 (27%), Positives = 48/83 (57%) Frame = +1 Query: 271 KVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSRL 450 K I C+KAL+I E+ KALFRR +A L+ +E++ D + +DP N+ + L + Sbjct: 1036 KCIKACNKALDIDKENIKALFRRGKALLNLKDYEKSKEDFTQVLELDPKNREAREQLKIV 1095 Query: 451 HTVVQERARQNAQTSNKVEQCLS 519 + ++++ ++ + + + + L+ Sbjct: 1096 NGMLKDHHQKEKKLYSNIFERLA 1118 >SB_50152| Best HMM Match : TPR_1 (HMM E-Value=0.0019) Length = 94 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/55 (41%), Positives = 32/55 (58%) Frame = +1 Query: 214 PCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEA 378 PC + S LK E+ I DC++AL++ KALFRR QA E ++ +EEA Sbjct: 41 PC--YLNSAACKLKLAEYPSAIEDCNEALKLDANSAKALFRRGQANEHMKDYEEA 93 >SB_19825| Best HMM Match : TPR_2 (HMM E-Value=4.8e-30) Length = 592 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = +1 Query: 238 GRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVD 411 G L K +E++K + ALE+ P DP L RS+ + L + + AYRDA+ D Sbjct: 23 GDVLFKQEEYQKALDSYSLALELKPTDPFCLVARSKCYLKLGKNDAAYRDAEAALEED 80 >SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) Length = 1104 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPKNS 268 A K+KGNDAF+S +Y+E++ +YT++I L + A NRA A K S Sbjct: 215 ANREKDKGNDAFRSGDYKESLVYYTRSIEL-----KPTAASYNNRAMAVRNVKTS 264 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/73 (24%), Positives = 41/73 (56%) Frame = +1 Query: 283 DCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSRLHTVV 462 D + AL + P++ KAL+RR+ A + L +++ A +D ++ +D N + + L + + Sbjct: 772 DANTALGLQPDNVKALYRRALARKALGKYDTAAKDLLSLVKIDSKNMSGKKELDTVLELC 831 Query: 463 QERARQNAQTSNK 501 ++ R+ ++ K Sbjct: 832 RKERRETQKSQPK 844 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 277 ISDCDKALEIIPEDPKALFRRSQAFECLER 366 + DC +L +IP+ KA +R++ FE LE+ Sbjct: 477 VKDCTSSLNLIPDSLKAHLKRAEQFEHLEK 506 >SB_44774| Best HMM Match : TPR_2 (HMM E-Value=6.3e-15) Length = 206 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/57 (40%), Positives = 32/57 (56%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPKNSKK 274 AE+ K +GN + +NY AI Y+KAI A +AT+ NR+AAY+ N K Sbjct: 34 AEAKKAEGNREYGLKNYVSAIALYSKAIEFAP----HVATFYGNRSAAYMMISNYDK 86 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/70 (28%), Positives = 33/70 (47%) Frame = +1 Query: 202 RQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAY 381 + P +F K ++ K+ I DCDKA +I P+ + R +A E L +E+A Sbjct: 77 KNPHSAPLFAKRASCFIRMKKPNAAIRDCDKAAQINPDSAQIYKWRGRAHEFLGHWEKAD 136 Query: 382 RDAKTIFTVD 411 +D +D Sbjct: 137 KDLAQALKLD 146 >SB_42049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGS 208 +++AE KN+GN K E +QEAI Y++AI L S Sbjct: 88 RQKAEELKNEGNQLMKEEKFQEAINSYSRAIELDNTNS 125 >SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) Length = 458 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEA 378 +FEK + D D A+ + P+ PK FRR +A L+ F +A Sbjct: 318 QFEKALQDADVAISLAPDWPKGFFRRGRALAGLKLFSDA 356 >SB_21064| Best HMM Match : TPR_2 (HMM E-Value=3.5e-09) Length = 372 Score = 37.9 bits (84), Expect = 0.009 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPT-NKAVQPI 438 E+ +VI LE ++ KALFRR++A + EEA D K +DP+ K V+ Sbjct: 288 EYYEVIKHTSTVLEKDKDNVKALFRRAKAHKACWDPEEARSDFKRAAELDPSLTKVVRKE 347 Query: 439 LSRLHTVVQERARQNAQTSNKV 504 +S L ++++ ++ + K+ Sbjct: 348 VSELDQMIKDHNAEDREKMKKL 369 >SB_8404| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 1981 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = +1 Query: 199 KRQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEA 378 K P ++ + ++T + E+ + D KA E+ P PKA +R+ A +C+ R EA Sbjct: 50 KLDPNNHVLYGNRSAACIRTWQLEQALEDGKKAAELNPLWPKAHYRQGVALQCMGRHAEA 109 Query: 379 YRDAKTIFTVD 411 T D Sbjct: 110 LAAFATALAQD 120 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +2 Query: 107 ESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRA 241 ++ K +GNDAF +YQ+A YT+A+ + K A NRA Sbjct: 34 QAKKQEGNDAFTGGHYQKAYELYTEALEIDPKNKSTNAKLYYNRA 78 Score = 35.5 bits (78), Expect = 0.050 Identities = 16/72 (22%), Positives = 40/72 (55%) Frame = +1 Query: 268 EKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSR 447 ++ I DC +A+ + KA +R+ + E++EEA RD +++ D +++ + +L + Sbjct: 88 DQAIEDCTQAMNLDHTYTKAYLKRANCYMESEKYEEAVRDYESLCKKDRSSREFRRLLEK 147 Query: 448 LHTVVQERARQN 483 +++ R++ Sbjct: 148 AKLELKKSKRKD 159 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +2 Query: 107 ESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRA 241 ++ K +GNDAF +YQ+A YT+A+ + K A NRA Sbjct: 34 QAKKQEGNDAFTGGHYQKAYELYTEALEIDPKNKSTNAKLYYNRA 78 Score = 35.5 bits (78), Expect = 0.050 Identities = 16/72 (22%), Positives = 40/72 (55%) Frame = +1 Query: 268 EKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSR 447 ++ I DC +A+ + KA +R+ + E++EEA RD +++ D +++ + +L + Sbjct: 88 DQAIEDCTQAMNLDHTYTKAYLKRANCYMESEKYEEAVRDYESLCKKDRSSREFRRLLEK 147 Query: 448 LHTVVQERARQN 483 +++ R++ Sbjct: 148 AKLELKKSKRKD 159 >SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.3 bits (80), Expect = 0.029 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAIN 190 K KGN AFK + Y+EA+ YT+A+N Sbjct: 124 KEKGNLAFKQQKYEEAVKLYTQALN 148 >SB_13361| Best HMM Match : TPR_2 (HMM E-Value=0.0021) Length = 304 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRA 241 E A SYK +GN +K +N+++AI YT+ I L + A NRA Sbjct: 82 ENALSYKEEGNYEYKRKNFKKAIDAYTEGIKLRCQDGHVNAILYTNRA 129 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 35.5 bits (78), Expect = 0.050 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINL 193 E E + +GN FK + +++A FYTKAINL Sbjct: 533 EICEGLRLRGNQYFKDKQFKQASVFYTKAINL 564 >SB_44772| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 845 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRD 214 +++AE +G + +NY+EAI Y +A+ L +K S D Sbjct: 188 RDQAEELMGRGRKYYDMDNYEEAIEHYKEALRLYQKTSDD 227 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRD 214 +++AE +G + +NY+EAI +A+ L +K S D Sbjct: 26 RDQAEELMGRGRKYYDMDNYEEAIGHSKEALRLYQKTSDD 65 >SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 K GN+AF + + A+ Y +A+NLA A NRAAA+++ Sbjct: 338 KTIGNEAFCKQQFLTAVNMYNEALNLAPNS----AVLYANRAAAFIK 380 >SB_17634| Best HMM Match : TPR_2 (HMM E-Value=0.06) Length = 118 Score = 31.9 bits (69), Expect = 0.62 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAI 187 ++A S K +GN FK +NY+EA+ Y +A+ Sbjct: 30 DQAFSLKEEGNGCFKQKNYREAMKKYHRAM 59 >SB_58067| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 593 Score = 31.9 bits (69), Expect = 0.62 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRD 214 QE+ +++ N GN K NY+EAI T A+ L EK D Sbjct: 448 QEQGDAHFNIGNLHCKLGNYEEAIVNLTDALRLFEKIHND 487 >SB_43858| Best HMM Match : TPR_2 (HMM E-Value=0.0013) Length = 517 Score = 31.9 bits (69), Expect = 0.62 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATY 226 EEA + K+ GN FK Y EAI YT A+ + R + + Sbjct: 431 EEALNLKDAGNKKFKQGCYVEAIKIYTSALEVCPPMKRPVTRH 473 >SB_35100| Best HMM Match : TPR_2 (HMM E-Value=0.0013) Length = 158 Score = 31.9 bits (69), Expect = 0.62 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATY 226 EEA + K+ GN FK Y EAI YT A+ + R + + Sbjct: 72 EEALNLKDAGNKKFKQGCYVEAIKIYTSALEVCPPMKRPVTRH 114 >SB_23911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.9 bits (69), Expect = 0.62 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 2/84 (2%) Frame = +1 Query: 211 RPCNIFKKSGRSLLKTKEFEKVI-SDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRD 387 R ++++ S LL+ E+ K ++ K L+ + KAL+RR+QA+ L+ +++ D Sbjct: 116 RAKDVWRLSASELLQLAEYHKAKGTEFFKVLQSEDTNIKALYRRAQAYLELDEIDKSRED 175 Query: 388 AKTIFTVDPT-NKAVQPILSRLHT 456 + VD +K ++ R T Sbjct: 176 IEKALQVDSAMHKTHSDVVLRFKT 199 >SB_6794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 101 EAESYKNKGNDAFKSENYQEAITFYTKAINLA 196 E +SY N GN AF +Y +A +Y K + +A Sbjct: 301 EGKSYGNLGNAAFARSDYTKAREYYNKCLEIA 332 >SB_39326| Best HMM Match : TPR_2 (HMM E-Value=3.5e-05) Length = 187 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 292 KALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSRL 450 + L+I P++ KALFR+ + EA K +DP NK ++ L L Sbjct: 2 QVLQIDPDNVKALFRKGKVLASKGELSEALPLIKKANQLDPNNKTIRAELRSL 54 >SB_37264| Best HMM Match : Complex1_LYR (HMM E-Value=4.2) Length = 180 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/60 (30%), Positives = 33/60 (55%) Frame = +3 Query: 564 MANLLVLAKENSGAEVMLKNGVVQRIQQLLKVEKNSEIYINAIRVIGQICKKNIERTRAV 743 M+ LVL K+ GA +++++ ++L +E++SE AIR + K+ E RA+ Sbjct: 1 MSGKLVLKKKVRGAHRGAATKLIRKVNEILDLEEHSEDEKLAIRQLRDSAKEKAETLRAL 60 >SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) Length = 1053 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 564 MANLLVLAKENSGAEVMLKNGVVQRIQQLLKVEKNSEIYINAIRVIGQICKKNIERT 734 M+ LVL K+ GA +++++ ++L +EK+SE AIR + K+ E T Sbjct: 1 MSGKLVLKKKVRGAHRGAARKLIRKVNEILDLEKHSEDEKLAIRQLRDSAKEKAETT 57 >SB_22290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 101 EAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 +A K++GN A + + Q+AI FYT+AI L + NR+AA+ + Sbjct: 8 KAAKLKDQGNAALSAGDTQKAIEFYTEAILLDPANH----VFYSNRSAAFAK 55 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 107 ESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDL 217 +++ GN K NY++AI +Y KA LAEK + D+ Sbjct: 306 KAFARIGNSYAKQNNYKDAIKYYNKA--LAEKRTPDV 340 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAY 250 K KGN+ FK ++ A YT+AI ++ D Y NRAA + Sbjct: 369 KEKGNEYFKKGDFPSAQKHYTEAI---KRNPEDAKLY-SNRAATF 409 >SB_42713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +3 Query: 582 LAKENSGAEVMLKNGVVQRIQQLLKVEKNSE--IYINAIRVIGQICKKNIERTR 737 L KE + E MLK ++Q QQL EK S+ Y+ ++ Q K E+ R Sbjct: 111 LEKEKAKGEEMLKTDILQLKQQLSSQEKESQNSDYLRQLQEENQSLKDECEKLR 164 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +3 Query: 582 LAKENSGAEVMLKNGVVQRIQQLLKVEKNSEIYINAIRVIGQICKKNIERTRAVLKVVGI 761 L +EN GAE L+ ++ + ++E N E ++N + V N+E T +V+ V GI Sbjct: 935 LIRENEGAEAQLERASSEQKDYITRLEVNVEEHVNQVHV-----ASNVEST-SVMVVDGI 988 >SB_31762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRD 214 Q + +++ N GN K NY+EAI T A+ L EK D Sbjct: 747 QAQGDAHFNIGNLNCKLGNYEEAIVNLTDALRLFEKIHND 786 >SB_31526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1248 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 7/91 (7%) Frame = +1 Query: 316 DPKALFRR--SQAFECLERFEEAYRDAKTIFTV-----DPTNKAVQPILSRLHTVVQERA 474 DPK R + E + R E+ + K IFT DP ++ L HT E Sbjct: 187 DPKTFIARIKPKVLELIGRQEKPIK-VKFIFTCGFIKEDPATAQIEEELGYFHTEKPEIV 245 Query: 475 RQNAQTSNKVEQCLSWLLG*VKILKNVRRPW 567 ++A S+ + ++LLG V++ + W Sbjct: 246 TESADLSDLFDTMTNYLLGLVELFQKQGSGW 276 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 564 MANLLVLAKENSGAEVMLKNGVVQRIQQLLKVEKNSEIYINAIRVIGQICKKNIERTRAV 743 M+ LVL K+ GA +++++ ++L +E++SE AIR K+ E RA+ Sbjct: 1 MSGQLVLKKKVRGAHRGAATKLIRKVNEILDLEEHSEDEKLAIRQHRDSAKEKAETVRAL 60 >SB_53163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 546 EKREKAMANLLVLAKENSGAEVMLKNGVVQRIQQLLKVEKNSE--IYINAIRVIGQICKK 719 E+ + L L KE + E MLK ++Q QQL EK S+ Y+ ++ Q K Sbjct: 50 EQIRELQVKLRQLEKEKAKGEEMLKTDILQLKQQLPSQEKESQNSDYLRQLQEENQSLKD 109 Query: 720 NIER 731 E+ Sbjct: 110 ECEK 113 >SB_31240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 7/91 (7%) Frame = +1 Query: 316 DPKALFRR--SQAFECLERFEEAYRDAKTIFTV-----DPTNKAVQPILSRLHTVVQERA 474 DPK R + E + R E+ + K IFT DP ++ L HT E Sbjct: 187 DPKTFIARIKPKVLELISRQEKPIK-VKFIFTCGFIKEDPATAQIEEELGYFHTEKPEIV 245 Query: 475 RQNAQTSNKVEQCLSWLLG*VKILKNVRRPW 567 ++ S+ + ++LLG V++ + W Sbjct: 246 TESTDLSDLFDTMTNYLLGLVELFQKQGSGW 276 >SB_54822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1652 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 628 TPFFNITSAPLFSFAKTNRLAMAFSRFSISSPNPKANL 515 +P NIT+ L S A ++A FSR S P+PK N+ Sbjct: 956 SPRQNITATSLKSSAP--KIAATFSRLSTVKPSPKPNI 991 >SB_48397| Best HMM Match : TPR_2 (HMM E-Value=6.6e-26) Length = 598 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 292 KALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDP 414 +ALEI P+D L RS + L F EA +DA + P Sbjct: 7 EALEIEPDDEDVLGCRSAVYTKLGMFNEARKDADRLIANVP 47 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 28.3 bits (60), Expect = 7.6 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +3 Query: 453 HCSTRASSPKCSNKQ*SGTMFKLAFG--LGEDIEKREKAMANLLVLAKENSGAEVMLK 620 HC+ SSP C K+ + KLA G L + I++ +K A + +++ +G V ++ Sbjct: 190 HCTQVTSSPGCYIKEETNLWEKLASGSPLNDCIQQIKKEQAGDISKSQDGTGCRVKVE 247 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,770,570 Number of Sequences: 59808 Number of extensions: 420056 Number of successful extensions: 1747 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1745 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -