BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30775 (796 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 30 0.095 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 30 0.095 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 29.9 bits (64), Expect = 0.095 Identities = 19/100 (19%), Positives = 44/100 (44%), Gaps = 8/100 (8%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKA--------LFRRSQAFECLERFEEA 378 +F + L + +++ DC ALE++ +A L RR+ A L ++ Sbjct: 319 LFLNRSAAHLALENYQRCAEDCSTALELLQPPVEANRRARVACLARRAAALVKLGFLQQG 378 Query: 379 YRDAKTIFTVDPTNKAVQPILSRLHTVVQERARQNAQTSN 498 Y + +DP +++ + RL ++E + +++ + Sbjct: 379 YEEMIAASRLDPDEASLRLEVDRLRRCIEEERKNRSESES 418 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 29.9 bits (64), Expect = 0.095 Identities = 23/103 (22%), Positives = 44/103 (42%), Gaps = 8/103 (7%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKA--------LFRRSQAFECLERFEEA 378 +F + L + +++ DC ALE++ +A L RR+ A L ++ Sbjct: 319 LFLNRSAAHLALENYQRCAEDCSTALELLQPPVEANRRARVACLARRAAALVKLGFLQQG 378 Query: 379 YRDAKTIFTVDPTNKAVQPILSRLHTVVQERARQNAQTSNKVE 507 Y + +DP +++ + RL ++E R+N S E Sbjct: 379 YEEMIAASRLDPDEASLRLEVDRLRRCIEEE-RENRSESESDE 420 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,041 Number of Sequences: 2352 Number of extensions: 13974 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -