BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30775 (796 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containi... 64 1e-10 At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain... 57 1e-08 At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain... 55 6e-08 At1g62390.1 68414.m07039 octicosapeptide/Phox/Bem1p (PB1) domain... 53 3e-07 At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain... 52 3e-07 At3g17970.1 68416.m02286 chloroplast outer membrane translocon s... 51 8e-07 At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / F... 47 1e-05 At5g09420.1 68418.m01091 chloroplast outer membrane translocon s... 46 3e-05 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 46 4e-05 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 46 4e-05 At4g30480.1 68417.m04327 tetratricopeptide repeat (TPR)-containi... 45 7e-05 At1g04130.1 68414.m00402 tetratricopeptide repeat (TPR)-containi... 43 2e-04 At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containi... 42 4e-04 At2g42810.1 68415.m05300 serine/threonine protein phosphatase, p... 42 5e-04 At3g54010.2 68416.m05972 peptidyl-prolyl cis-trans isomerase, pu... 41 8e-04 At3g54010.1 68416.m05971 peptidyl-prolyl cis-trans isomerase, pu... 41 8e-04 At1g78120.1 68414.m09104 tetratricopeptide repeat (TPR)-containi... 41 8e-04 At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, pu... 41 0.001 At5g21990.1 68418.m02557 tetratricopeptide repeat (TPR)-containi... 41 0.001 At4g12400.1 68417.m01960 stress-inducible protein, putative simi... 41 0.001 At3g21640.1 68416.m02729 FKBP-type peptidyl-prolyl cis-trans iso... 40 0.002 At1g12270.1 68414.m01419 stress-inducible protein, putative simi... 40 0.003 At1g58450.1 68414.m06649 peptidyl-prolyl cis-trans isomerase FKB... 39 0.003 At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containi... 39 0.004 At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containi... 39 0.004 At1g56440.1 68414.m06491 serine/threonine protein phosphatase-re... 38 0.006 At1g56090.1 68414.m06441 tetratricopeptide repeat (TPR)-containi... 38 0.006 At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containi... 38 0.008 At1g62740.1 68414.m07081 stress-inducible protein, putative simi... 38 0.008 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 38 0.010 At1g01740.1 68414.m00093 protein kinase family protein low simil... 37 0.018 At3g04710.1 68416.m00505 ankyrin repeat family protein contains ... 36 0.023 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 36 0.031 At1g80410.1 68414.m09413 acetyltransferase-related low similarit... 36 0.031 At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-conta... 35 0.072 At1g18660.4 68414.m02326 zinc finger (C3HC4-type RING finger) fa... 34 0.12 At1g18660.3 68414.m02329 zinc finger (C3HC4-type RING finger) fa... 34 0.12 At1g18660.2 68414.m02328 zinc finger (C3HC4-type RING finger) fa... 34 0.12 At1g18660.1 68414.m02327 zinc finger (C3HC4-type RING finger) fa... 34 0.12 At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-conta... 33 0.17 At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi... 33 0.17 At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearl... 32 0.38 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 32 0.50 At4g23570.2 68417.m03396 phosphatase-related low similarity to p... 32 0.50 At4g23570.1 68417.m03395 phosphatase-related low similarity to p... 32 0.50 At4g11655.1 68417.m01863 transmembrane protein, putative contain... 31 0.67 At3g09240.1 68416.m01098 protein kinase-related low similarity t... 31 0.67 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 31 0.88 At5g46570.1 68418.m05734 protein kinase family protein contains ... 30 1.5 At2g15790.1 68415.m01810 peptidyl-prolyl cis-trans isomerase / c... 30 1.5 At1g24330.1 68414.m03069 armadillo/beta-catenin repeat family pr... 30 1.5 At4g00710.1 68417.m00097 protein kinase family protein low simil... 29 2.7 At5g42340.1 68418.m05155 armadillo/beta-catenin repeat family pr... 29 3.6 At5g10090.1 68418.m01169 tetratricopeptide repeat (TPR)-containi... 29 3.6 At5g03860.1 68418.m00358 malate synthase, putative strong simila... 29 3.6 At5g03360.1 68418.m00289 DC1 domain-containing protein contains ... 29 3.6 At5g01060.1 68418.m00009 protein kinase family protein contains ... 29 3.6 At3g50030.1 68416.m05470 hypothetical protein 29 3.6 At5g41260.1 68418.m05015 protein kinase family protein contains ... 29 4.7 At3g56210.1 68416.m06247 expressed protein 29 4.7 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 29 4.7 At5g59010.1 68418.m07392 protein kinase-related low similarity t... 28 6.2 At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containi... 28 8.2 At3g54030.1 68416.m05974 protein kinase family protein contains ... 28 8.2 At2g33360.1 68415.m04089 expressed protein 28 8.2 >At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 277 Score = 63.7 bits (148), Expect = 1e-10 Identities = 36/99 (36%), Positives = 55/99 (55%), Gaps = 1/99 (1%) Frame = +1 Query: 238 GRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPT 417 G LK + E+ I +C KALE+ P KAL RR++A E LE FE+A D K I +DP+ Sbjct: 153 GVCFLKLGKCEETIKECTKALELNPTYNKALVRRAEAHEKLEHFEDAVTDLKKILELDPS 212 Query: 418 NKAVQPILSRLHTVVQE-RARQNAQTSNKVEQCLSWLLG 531 N + + RL + E R + + K+++ + +LG Sbjct: 213 NDQARKGIRRLEPLAAEKREKMKEEAITKLKEMGNSILG 251 >At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 811 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/70 (35%), Positives = 42/70 (60%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPIL 441 E+ IS+C+ ALE P KAL RRS+ +E L + + A+RDA+ + ++P N + I Sbjct: 106 EYPNAISECNLALEASPRYSKALVRRSRCYEALNKLDYAFRDARIVLNMEPGNVSANEIF 165 Query: 442 SRLHTVVQER 471 R+ V+ ++ Sbjct: 166 DRVKKVLVDK 175 >At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 809 Score = 54.8 bits (126), Expect = 6e-08 Identities = 24/74 (32%), Positives = 41/74 (55%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 L+ EF K I +CD AL + P+ KAL +R++ +E L + + A RD + +DP N Sbjct: 177 LEPGEFAKAIHECDLALSVTPDHNKALLKRARCYEALNKLDLALRDVCMVSKLDPKNPMA 236 Query: 430 QPILSRLHTVVQER 471 I+ +L ++ + Sbjct: 237 SEIVEKLKRTLESK 250 >At1g62390.1 68414.m07039 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 751 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/71 (36%), Positives = 41/71 (57%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 +K ++E VIS+C AL+ P +AL RR++AFE + +F+ A +D + DP +K Sbjct: 102 MKPIDYESVISECSMALKSQPGFTRALLRRARAFEAVGKFDLAVQDVNVLLGSDPNHKDA 161 Query: 430 QPILSRLHTVV 462 I RL T + Sbjct: 162 GEISKRLKTAL 172 Score = 36.3 bits (80), Expect = 0.023 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPK 262 + A K +GN F++ +Y A+ Y I L K D A + NRAA ++ K Sbjct: 49 KRAHELKEEGNKKFQARDYVGALEQYENGIKLIPKSHPDRAVFHSNRAACLMQMK 103 >At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 697 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/67 (31%), Positives = 40/67 (59%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPIL 441 E+ I++C+ ALE P KAL +R++ +E L + + A+RD++ + ++P N + I Sbjct: 107 EYPNAINECNLALEASPRFSKALLKRARCYEALNKLDFAFRDSRVVLNMEPENVSANEIF 166 Query: 442 SRLHTVV 462 R+ V+ Sbjct: 167 ERVKKVL 173 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +2 Query: 77 DYTMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 D T+ + E K +GN F+ +Y+ A+ Y KA+ L + D+A + A+ Y++ Sbjct: 44 DMTIFINRALE-LKEEGNKLFQKRDYEGAMFRYDKAVKLLPRDHGDVAYLRTSMASCYMQ 102 >At3g17970.1 68416.m02286 chloroplast outer membrane translocon subunit, putative similar to Toc64 [Pisum sativum] GI:7453538; contains Pfam profile PF00515 TPR Domain Length = 589 Score = 51.2 bits (117), Expect = 8e-07 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 +E AE K KGN AFK + +Q+AI Y++AI L++ ATY NRAAAYL Sbjct: 471 EESAEIAKEKGNQAFKEKLWQKAIGLYSEAIKLSDNN----ATYYSNRAAAYL 519 >At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / FK506-binding protein (ROF1) identical to rotamase FKBP (ROF1) GB:U49453 [Arabidopsis thaliana] (Mol. Gen. Genet. 252 (5), 510-517 (1996)) Length = 551 Score = 47.2 bits (107), Expect = 1e-05 Identities = 26/80 (32%), Positives = 44/80 (55%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 LK K++++ C K LE+ + KAL+RR+QA+ L + A D K +DP N+ V Sbjct: 460 LKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMELSDLDLAEFDVKKALEIDPNNREV 519 Query: 430 QPILSRLHTVVQERARQNAQ 489 + RL ++E ++ A+ Sbjct: 520 KLEQKRLKEKMKEFNKKEAK 539 >At5g09420.1 68418.m01091 chloroplast outer membrane translocon subunit, putative similar to component of chloroplast outer membrane translocon Toc64 [Pisum sativum] GI:7453538; contains Pfam profiles PF01425: Amidase, PF00515: TPR Domain Length = 603 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/52 (48%), Positives = 34/52 (65%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 E +E K KGN A+K + + +A+ FYT+AI L G+ ATY NRAAA+L Sbjct: 486 EASEVMKEKGNAAYKGKQWNKAVNFYTEAIKL--NGAN--ATYYCNRAAAFL 533 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 45.6 bits (103), Expect = 4e-05 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 2/84 (2%) Frame = +1 Query: 265 FEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILS 444 +EK + DC++AL I P KAL RR+ ++ L R+E+A RD + + P + V L Sbjct: 499 WEKSVDDCNQALRIQPSYTKALLRRAASYGKLGRWEDAVRDYEVLRKELPGDSEVAESLQ 558 Query: 445 RLHTVVQERARQNAQT--SNKVEQ 510 R + ++ + +N+VE+ Sbjct: 559 RARNALSNKSEEPKYLGFNNEVEE 582 Score = 35.1 bits (77), Expect = 0.054 Identities = 18/75 (24%), Positives = 35/75 (46%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 KK+G + + + + ++ D+A+ + PE+P R+ A R EEA ++ Sbjct: 215 KKAGNVMYRKGNYAEALALYDRAISLSPENPAYRSNRAAALAASGRLEEAVKECLEAVRC 274 Query: 409 DPTNKAVQPILSRLH 453 DP+ L+ L+ Sbjct: 275 DPSYARAHQRLASLY 289 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 45.6 bits (103), Expect = 4e-05 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 2/83 (2%) Frame = +1 Query: 265 FEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILS 444 +EK + DC+ AL+ P KAL RR+ ++ L R+E+A +D + + P + V L Sbjct: 508 WEKSVEDCNHALKSQPSYIKALLRRAASYGKLGRWEDAVKDYEFLRRELPGDSEVAESLE 567 Query: 445 RLHTVVQERARQNAQT--SNKVE 507 R TV+ R++++ +N+VE Sbjct: 568 RAKTVLMNRSQESKSLGFNNEVE 590 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/75 (24%), Positives = 33/75 (44%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 K+ G + + F + +S D+A+ I P + R+ A L R EA ++ + Sbjct: 224 KRMGNDMYRRGSFSEALSLYDRAILISPGNAAYRSNRAAALTALRRLGEAVKECLEAVRI 283 Query: 409 DPTNKAVQPILSRLH 453 DP+ L+ L+ Sbjct: 284 DPSYSRAHQRLASLY 298 >At4g30480.1 68417.m04327 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 208 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = +1 Query: 238 GRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEA 378 G LK + E+ I +C KALE+ P KAL RR++A E LE FE+A Sbjct: 153 GVCFLKLGKCEETIKECTKALELNPTYNKALVRRAEAHEKLEHFEDA 199 >At1g04130.1 68414.m00402 tetratricopeptide repeat (TPR)-containing protein contains non-consensus donor splice site AT at exon 4 and acceptor splice site at exon5; Contains similarity to serine/threonine protein phosphatase gb|X83099 from S. cerevisiae, SP|O95801 Tetratricopeptide repeat protein 4 Homo sapiens; contains Pfam profile PF00515: TPR Domain Length = 360 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/102 (23%), Positives = 52/102 (50%), Gaps = 3/102 (2%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIF 402 +F L + + ++D ++++ + P + KA++R ++A L+ EA + Sbjct: 73 LFSNRSHVNLLLGNYRRALTDAEESMRLSPHNVKAVYRAAKASMSLDLLNEAKSYCEKGI 132 Query: 403 TVDPTNKAVQPILSRLHTVVQERARQNAQTSNKV---EQCLS 519 DP+N+ ++ +L +++ QE+ + AQ S V + CLS Sbjct: 133 ENDPSNEDMKKLLKLVNSKKQEKEQHEAQASQAVVEAKACLS 174 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKS--ENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPKNS 268 + A +K +GN+ + ++Y EAI YTKAI+ + + NR+ L N Sbjct: 28 ESTAIEFKEEGNECVRKGKKHYSEAIDCYTKAISQGVLSDSETSILFSNRSHVNLLLGNY 87 Query: 269 KK 274 ++ Sbjct: 88 RR 89 >At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containing protein low similarity to protein antigen LmSTI1 [Leishmania major] GI:1698880; contains Pfam profile PF00515 TPR Domain; EST gb|Z47802 and gb|Z48402 come from this gene Length = 328 Score = 42.3 bits (95), Expect = 4e-04 Identities = 39/106 (36%), Positives = 52/106 (49%), Gaps = 5/106 (4%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR-PKNSK- 271 E +S K KGN+ FK+ N+ +A YT+AI L AT NRAAA+L K SK Sbjct: 13 EAEKSLKEKGNEFFKAGNFLKAAALYTQAIKLDPSN----ATLYSNRAAAFLSLVKLSKA 68 Query: 272 -K*SVTVIKL*K*YQK--IRKPCSGDRKLLNVWRDLKKPTEMPKQY 400 + T IKL ++K RK C + + + D EM QY Sbjct: 69 LADAETTIKLNPQWEKGYFRKGCV--LEAMEKYEDALAAFEMALQY 112 >At2g42810.1 68415.m05300 serine/threonine protein phosphatase, putative similar to SP|P53042 Serine/threonine protein phosphatase 5 (EC 3.1.3.16) (PP5) (Protein phosphatase T) (PPT) {Rattus norvegicus}; contains Pfam profiles PF00149: Ser/Thr protein phosphatase, PF00515: TPR Domain Length = 484 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 AE +K++ N+AFK Y AI YTKAI L + + A Y NRA A+ + Sbjct: 13 AEEFKSQANEAFKGHKYSSAIDLYTKAIEL----NSNNAVYWANRAFAHTK 59 >At3g54010.2 68416.m05972 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative / pasticcino 1-D (PAS1-D) nearly identical to pasticcino 1-D [Arabidopsis thaliana] GI:3080740 Length = 545 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/60 (35%), Positives = 32/60 (53%) Frame = +1 Query: 247 LLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKA 426 LLK E+ K I C+K LE P K L+RR A+ +++A D + VD +++A Sbjct: 369 LLKMGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNMMIKVDKSSEA 428 >At3g54010.1 68416.m05971 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative / pasticcino 1-D (PAS1-D) nearly identical to pasticcino 1-D [Arabidopsis thaliana] GI:3080740 Length = 635 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/60 (35%), Positives = 32/60 (53%) Frame = +1 Query: 247 LLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKA 426 LLK E+ K I C+K LE P K L+RR A+ +++A D + VD +++A Sbjct: 459 LLKMGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNMMIKVDKSSEA 518 >At1g78120.1 68414.m09104 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 530 Score = 41.1 bits (92), Expect = 8e-04 Identities = 23/87 (26%), Positives = 41/87 (47%) Frame = +1 Query: 193 GRKRQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFE 372 G + P + S K FEK I DC AL + P KA RR+ ++ LE+++ Sbjct: 420 GLENDPYNALLLCNRAASRFKLDLFEKAIEDCTLALSLQPSYRKARRRRADSYAKLEKWQ 479 Query: 373 EAYRDAKTIFTVDPTNKAVQPILSRLH 453 A +D + + P ++ + L+ ++ Sbjct: 480 HAIQDYELLMMETPEDEETRRALTEVN 506 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 101 EAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 + E+ K GN+ + + +A+ FY +AI+ K TY N++AA + Sbjct: 158 DPETLKKMGNEEYCRGRFGQALVFYERAISADPK----TPTYWSNKSAALI 204 >At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative similar to rof1 [Arabidopsis thaliana] GI:1373396 Length = 578 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 1/90 (1%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 LK K++++ K LE+ + KA++RR+ A+ + A D K +DP NK V Sbjct: 470 LKLKDYKEAAKLSTKVLEMDSRNVKAMYRRAHAYLETADLDLAELDIKKALEIDPDNKEV 529 Query: 430 QPILSRLHTVVQERARQNAQ-TSNKVEQCL 516 + +L V+E +++A+ SN + + L Sbjct: 530 KIEYKKLKEKVKEYNKKDAKFYSNMLSKML 559 >At5g21990.1 68418.m02557 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 554 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 LKT + E+ I + + L + KAL+RR QA+ L FE+A D V P ++ + Sbjct: 157 LKTNQHEECIKEGSEVLGYDARNVKALYRRGQAYRDLGLFEDAVSDLSKAHEVSPEDETI 216 Query: 430 QPIL 441 +L Sbjct: 217 ADVL 220 >At4g12400.1 68417.m01960 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 530 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/53 (41%), Positives = 35/53 (66%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 +E+A K +GN A+K +++ A+ YTKA+ L ++ D+ +YL NRAA YL Sbjct: 227 KEKALKEKGEGNVAYKKKDFGRAVEHYTKAMELDDE---DI-SYLTNRAAVYL 275 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIF 402 ++ S +E+ +SD K +E+ P+ K R AF L +F+EA K Sbjct: 38 LYSNRSASYASLHRYEEALSDAKKTIELKPDWSKGYSRLGAAFIGLSKFDEAVDSYKKGL 97 Query: 403 TVDPTNKAVQ 432 +DP+N+ ++ Sbjct: 98 EIDPSNEMLK 107 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAY 250 AE K+KGN AF S +Y AIT +T+AINL+ NR+A+Y Sbjct: 2 AEEAKSKGNAAFSSGDYATAITHFTEAINLSPTNH----ILYSNRSASY 46 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 AE + KGN FK + Y EA+ Y++AI ++ D+ Y NRAA Y + Sbjct: 369 AEEEREKGNGFFKEQKYPEAVKHYSEAI---KRNPNDVRAY-SNRAACYTK 415 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 K G + + ++ I+ +A+ + P + RS ++ L R+EEA DAK + Sbjct: 6 KSKGNAAFSSGDYATAITHFTEAINLSPTNHILYSNRSASYASLHRYEEALSDAKKTIEL 65 Query: 409 DP 414 P Sbjct: 66 KP 67 Score = 31.1 bits (67), Expect = 0.88 Identities = 13/63 (20%), Positives = 30/63 (47%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 ++ G K +++ + + +A++ P D +A R+ + L E +DA+ + Sbjct: 373 REKGNGFFKEQKYPEAVKHYSEAIKRNPNDVRAYSNRAACYTKLGALPEGLKDAEKCIEL 432 Query: 409 DPT 417 DP+ Sbjct: 433 DPS 435 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRD 387 K G K K+F + + KA+E+ ED L R+ + + ++EE D Sbjct: 234 KGEGNVAYKKKDFGRAVEHYTKAMELDDEDISYLTNRAAVYLEMGKYEECIED 286 >At3g21640.1 68416.m02729 FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to rof1 [Arabidopsis thaliana] GI:1354207; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 365 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/92 (30%), Positives = 45/92 (48%) Frame = +1 Query: 214 PCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAK 393 PC++ L+K K +++ I C+ L ++PKALFRR +A L + + A D + Sbjct: 231 PCHL--NIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFR 288 Query: 394 TIFTVDPTNKAVQPILSRLHTVVQERARQNAQ 489 P +KA++ L L QE+A Q Sbjct: 289 KAQKYAPDDKAIRRELRAL--AEQEKALYQKQ 318 >At1g12270.1 68414.m01419 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 572 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/53 (39%), Positives = 35/53 (66%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 +E+A+ K GN A+K ++++ AI Y+ AI + ++ D++ YL NRAA YL Sbjct: 241 KEKAKKEKELGNAAYKKKDFETAIQHYSTAIEIDDE---DIS-YLTNRAAVYL 289 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 + KGND FK + Y EAI YT+AI ++ D Y NRAA+Y + Sbjct: 387 REKGNDFFKEQKYPEAIKHYTEAI---KRNPNDHKAY-SNRAASYTK 429 Score = 35.9 bits (79), Expect = 0.031 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIF 402 +F + ++ + +SD + +++ P PK R A L +FE A K Sbjct: 38 LFSNRSAAHASLHQYAEALSDAKETIKLKPYWPKGYSRLGAAHLGLNQFELAVTAYKKGL 97 Query: 403 TVDPTNKAVQPILSRLH-TVVQERARQN 483 VDPTN+A++ L+ +V + RA N Sbjct: 98 DVDPTNEALKSGLADAEASVARSRAAPN 125 Score = 34.3 bits (75), Expect = 0.095 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 ++ G K +++ + I +A++ P D KA R+ ++ L E +DA+ + Sbjct: 387 REKGNDFFKEQKYPEAIKHYTEAIKRNPNDHKAYSNRAASYTKLGAMPEGLKDAEKCIEL 446 Query: 409 DPT 417 DPT Sbjct: 447 DPT 449 >At1g58450.1 68414.m06649 peptidyl-prolyl cis-trans isomerase FKBP-type family protein similar to rof1 from (Arabidopsis thaliana) GI:1373396, GI:1354207; contains Pfam profile PF00515 TPR Domain Length = 164 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAV 429 LK K F + I C + L+I ++ KAL+RR+Q++ + A D DP N+ V Sbjct: 69 LKLKNFLETIVLCSEVLDIEFQNVKALYRRAQSYIEVGDLISAEMDINRALEADPENREV 128 Query: 430 QPILSRLHTVVQERARQNAQ 489 + + + E R++A+ Sbjct: 129 KSLYKAMKLSKAESDRRDAK 148 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKG 205 E A K +GN +K++ Y+ A Y KA E G Sbjct: 8 EAANRKKEEGNLLYKTQKYERAAKKYNKAAECIENG 43 >At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containing protein glutamine-rich tetratricopeptide repeat (TPR) containing protein (SGT) - Rattus norvegicus,PID:e1285298 (SP|O70593); contains Pfam profile PF00515 TPR Domain Length = 426 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/56 (42%), Positives = 31/56 (55%) Frame = +2 Query: 83 TMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAY 250 T V AE+ K +GN A +S Y EA+ Y+ AI L +K A + NRAAAY Sbjct: 168 TFDVNSLAETLKCQGNKAMQSNLYLEAVELYSFAIALTDKN----AVFYCNRAAAY 219 >At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containing protein / U-box domain-containing protein similar to serologically defined colon cancer antigen 7 GB:5031963 GI:3170178 [Homo sapiens]; Length = 278 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/64 (37%), Positives = 33/64 (51%) Frame = +2 Query: 83 TMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPK 262 T V AE K GN+ FK E + AI YT+AI L S ++ Y NRA +++ K Sbjct: 3 TGVASAMAERLKEDGNNCFKKERFGAAIDAYTEAIAL----SPNVPAYWTNRALCHMKRK 58 Query: 263 NSKK 274 + K Sbjct: 59 DWTK 62 >At1g56440.1 68414.m06491 serine/threonine protein phosphatase-related similar to SP|Q60676 Serine/threonine protein phosphatase 5 (EC 3.1.3.16) (PP5) (Protein phosphatase T) (PPT) Mus musculus, Tetratricopeptide Repeats Of Protein Phosphatase 5 [Homo sapiens] GI:3212250; contains Pfam profile: PF00515: TPR Domain Length = 476 Score = 38.3 bits (85), Expect = 0.006 Identities = 31/98 (31%), Positives = 50/98 (51%), Gaps = 3/98 (3%) Frame = +2 Query: 101 EAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPKNSKK*S 280 ++ S K +GN+ FK + + EAI Y+++I L S + TY NRA AYL+ K ++ Sbjct: 83 DSSSEKEQGNEFFKQKKFNEAIDCYSRSIAL----SPNAVTY-ANRAMAYLKIKRYREAE 137 Query: 281 V---TVIKL*K*YQKIRKPCSGDRKLLNVWRDLKKPTE 385 V + L Y K + RK L + ++ K+ E Sbjct: 138 VDCTEALNLDDRYIKAYSRRATARKELGMIKEAKEDAE 175 >At1g56090.1 68414.m06441 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain; similar to infertility-related sperm protein [Homo sapiens] GI:10863768, TPR-containing protein involved in spermatogenesis TPIS [Mus musculus] GI:6272680 Length = 272 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = +2 Query: 122 KGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 KG+ ++ Y+EA+ FYT+A+ A+ + +A + NRAA YL+ Sbjct: 13 KGHQLYRDGKYKEALLFYTEALTAAKAKPQKIALH-SNRAACYLK 56 >At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 593 Score = 37.9 bits (84), Expect = 0.008 Identities = 26/98 (26%), Positives = 43/98 (43%) Frame = +1 Query: 193 GRKRQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFE 372 G PR + K +F+K I DC AL + P KA RR+ +E++E Sbjct: 496 GLDHDPRNSVLLCNRAACRSKLGQFDKSIEDCTAALSVRPGYGKARLRRADCNAKIEKWE 555 Query: 373 EAYRDAKTIFTVDPTNKAVQPILSRLHTVVQERARQNA 486 A D + + P ++ V LS + +R+ Q++ Sbjct: 556 LAVGDYEILKKESPEDEQVIRGLSEAQQQLMKRSGQDS 593 >At1g62740.1 68414.m07081 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 571 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 + KGND FK + Y +A+ YT+AI ++ +D Y NRAA Y + Sbjct: 386 REKGNDFFKEQKYPDAVRHYTEAI---KRNPKDPRAY-SNRAACYTK 428 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/63 (23%), Positives = 31/63 (49%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 ++ G K +++ + +A++ P+DP+A R+ + L E +DA+ + Sbjct: 386 REKGNDFFKEQKYPDAVRHYTEAIKRNPKDPRAYSNRAACYTKLGAMPEGLKDAEKCIEL 445 Query: 409 DPT 417 DPT Sbjct: 446 DPT 448 Score = 32.3 bits (70), Expect = 0.38 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAY 250 A+ K KGN AF S ++ A+ +T AINL NR+AA+ Sbjct: 2 ADEAKAKGNAAFSSGDFNSAVNHFTDAINLTPTNH----VLFSNRSAAH 46 Score = 32.3 bits (70), Expect = 0.38 Identities = 16/70 (22%), Positives = 32/70 (45%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIF 402 +F + +++ +SD K +E+ P+ K R A L +F+EA Sbjct: 38 LFSNRSAAHASLNHYDEALSDAKKTVELKPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGL 97 Query: 403 TVDPTNKAVQ 432 +DP+N+ ++ Sbjct: 98 EIDPSNEGLK 107 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 5/107 (4%) Frame = +1 Query: 214 PCNIFKKSGRSL--LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRD 387 PCN R+ K +E+ I DC++AL P K L RR+ + +ER+ A D Sbjct: 496 PCNAILYCNRAACWFKLGMWERSIEDCNQALRYQPSYTKPLLRRAASNSKMERWGAAVSD 555 Query: 388 AKTIFTVDPTNKAVQPILSRLHTVVQERARQ---NAQTSNKVEQCLS 519 + + P +K V L +++ + N + +VE+ S Sbjct: 556 YEALIRELPHDKEVAESLFHAQVALKKSRGEEVLNMEFGGEVEEIYS 602 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 122 KGNDAFKSENYQEAITFYTKAINL 193 +GND +KSE Y EA + Y + + L Sbjct: 471 RGNDLYKSERYTEASSAYAEGLRL 494 >At1g01740.1 68414.m00093 protein kinase family protein low similarity to protein kinase [Arabidopsis thaliana] GI:2852449; contains Pfam profile: PF00069 Protein kinase domain Length = 483 Score = 36.7 bits (81), Expect = 0.018 Identities = 21/59 (35%), Positives = 35/59 (59%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPKNSKK 274 +EA + K KG+ AF+ +++ EAI FYT+ ++L AT L R+ +YL +K+ Sbjct: 373 QEAINSKKKGDIAFRRKDFSEAIEFYTQFLDLGMIS----ATVLVRRSQSYLMSNMAKE 427 >At3g04710.1 68416.m00505 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 456 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 235 SGRSL--LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEA 378 S RSL L+ + E +SD E+ P+ PK FR A L+RF+EA Sbjct: 366 SNRSLCWLRLGQAEHALSDAKACRELNPDWPKGCFREGAALRLLQRFDEA 415 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +2 Query: 101 EAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 +A K +G DAF +++Q AI YT+AI+ T NR+ +LR Sbjct: 327 KAAEAKARGQDAFHRKDFQMAIDAYTQAIDFDPTDH----TLFSNRSLCWLR 374 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 K G+ K+F+ I +A++ P D RS + L + E A DAK + Sbjct: 332 KARGQDAFHRKDFQMAIDAYTQAIDFDPTDHTLFSNRSLCWLRLGQAEHALSDAKACREL 391 Query: 409 DP 414 +P Sbjct: 392 NP 393 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 35.9 bits (79), Expect = 0.031 Identities = 27/112 (24%), Positives = 46/112 (41%), Gaps = 3/112 (2%) Frame = +1 Query: 193 GRKRQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFE 372 G K P + K +E I DC+ AL I+P K +R+ + LER+ Sbjct: 522 GLKYDPSNATLLCYRADCFFKVGMWESSIEDCNHALLILPSYTKPRLQRAALYTKLERWA 581 Query: 373 EAYRDAKTIFTVDPTNKAVQPILSRLHTVVQERARQ---NAQTSNKVEQCLS 519 EA D + + P +K + L +++ + N + +VE+ S Sbjct: 582 EAVSDYEILRKELPYDKEIAESLFHAQVALKKSRGEVVLNMEFGGEVEEISS 633 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 331 FRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSRLHTVVQERARQN 483 F +SQ L RFE A A+ +DP N V+ + + + + R R N Sbjct: 454 FVKSQMELALGRFENAVVTAEKASKIDPQNNEVEILYKNVRLITRARDRGN 504 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/62 (22%), Positives = 28/62 (45%) Frame = +1 Query: 229 KKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTV 408 K+ G + + F + + D+A+E+ P + R+ A L + EA + + + Sbjct: 262 KRFGNEMFRKGCFAEALKLYDRAIELSPSNATYHSNRAAALSSLGQIGEAVNECEIAIKL 321 Query: 409 DP 414 DP Sbjct: 322 DP 323 >At1g80410.1 68414.m09413 acetyltransferase-related low similarity to acetyltransferase Tubedown-1 [Mus musculus] GI:8497318, N-TERMINAL ACETYLTRANSFERASE GB:P12945 from (Saccharomyces cerevisiae); contains Pfam profile PF00515 TPR Domain Length = 897 Score = 35.9 bits (79), Expect = 0.031 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +1 Query: 193 GRKRQPRPCNIFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFE 372 G P+ N+FK +S +TK+++K + D L+ P+ + L + C++R Sbjct: 2 GASLPPKEANLFKLIVKSY-ETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT 60 Query: 373 EAY 381 EAY Sbjct: 61 EAY 63 >At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1108 Score = 34.7 bits (76), Expect = 0.072 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +2 Query: 113 YKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAA 247 YKN GN+A + Y EA+ YT A++ A NRAAA Sbjct: 835 YKNAGNEAVRDRKYMEAVEQYTAALSRNVDSRPFAAICFCNRAAA 879 >At1g18660.4 68414.m02326 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 491 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 122 KGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 KGN +FK ++EAI+ Y+KA ++ L NR+AAY+R Sbjct: 45 KGNQSFKESRFEEAISSYSKANSIKPLD----PIVLGNRSAAYIR 85 >At1g18660.3 68414.m02329 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 486 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 122 KGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 KGN +FK ++EAI+ Y+KA ++ L NR+AAY+R Sbjct: 45 KGNQSFKESRFEEAISSYSKANSIKPLD----PIVLGNRSAAYIR 85 >At1g18660.2 68414.m02328 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 486 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 122 KGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 KGN +FK ++EAI+ Y+KA ++ L NR+AAY+R Sbjct: 45 KGNQSFKESRFEEAISSYSKANSIKPLD----PIVLGNRSAAYIR 85 >At1g18660.1 68414.m02327 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 486 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 122 KGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 KGN +FK ++EAI+ Y+KA ++ L NR+AAY+R Sbjct: 45 KGNQSFKESRFEEAISSYSKANSIKPLD----PIVLGNRSAAYIR 85 >At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-containing protein similarity to TETRATRICOPEPTIDE REPEAT PROTEIN 2 , human, SWISSPROT:TTC2_HUMAN; contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1165 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAY 250 K GN+AF+S + EA+ YT A+ + A NRAAAY Sbjct: 883 KAAGNEAFQSGRHTEAVEHYTAALACNVESRPFTAVCFCNRAAAY 927 >At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 798 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRD-----LATYLKNRA 241 +E + K +GN F+S ++ EA+ Y+KA+ +A + D LA+ NRA Sbjct: 60 EETSLDLKRRGNHCFRSRDFDEALRLYSKALRVAPLDAIDGDKSLLASLFLNRA 113 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/71 (22%), Positives = 34/71 (47%) Frame = +1 Query: 277 ISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPTNKAVQPILSRLHT 456 + DC +AL I P KA +RR + L +++A+RD +++ + + + + L Sbjct: 126 LRDCHRALRIDPYYAKAWYRRGKLNTLLGNYKDAFRDITVSMSLESSLVGKKQLQNELKA 185 Query: 457 VVQERARQNAQ 489 + + Q + Sbjct: 186 IPDYQNNQTLE 196 >At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearly identical to acyl-activating enzyme 18 [Arabidopsis thaliana] GI:29893268; similar to acetyl-CoA synthetase [SP|P27095] from Methanothrix soehngenii; contains Pfam AMP-binding enzyme domain PF00501l; identical to cDNA acyl-activating enzyme 18 (At1g55320) GI: 29893267 Length = 725 Score = 32.3 bits (70), Expect = 0.38 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +1 Query: 217 CNIFKKSGRSLLKTKEFEKVISD-CDKALEIIPEDP-KALFRRS 342 C+ + K+G +L KEF+K++SD KA+E P D KAL S Sbjct: 10 CDDYVKAGLTLEDAKEFDKLVSDVITKAIETDPRDQWKALVDES 53 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/77 (22%), Positives = 37/77 (48%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIF 402 +F+++ +S+ K K + + D + A+E P +A F+R+ R+E++ + Sbjct: 53 LFERASQSI-KVKRYSDALDDLNAAIEADPALSEAYFKRASVLRHFCRYEDSENSYQKYL 111 Query: 403 TVDPTNKAVQPILSRLH 453 + + LS+LH Sbjct: 112 EFKSGDSNAEKELSQLH 128 >At4g23570.2 68417.m03396 phosphatase-related low similarity to phosphoprotein phosphatase [Mus musculus] GI:567040; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 350 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPT 417 +F+ + KA+++ P + R+QA+ LE F EA DA +DP+ Sbjct: 17 DFDVAVDLYSKAIDLDPNCAEFFADRAQAYIKLESFTEAVADANKAIELDPS 68 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 A+ +K +AF +++ A+ Y+KAI+L + A + +RA AY++ Sbjct: 2 AKELADKAKEAFVDDDFDVAVDLYSKAIDL----DPNCAEFFADRAQAYIK 48 >At4g23570.1 68417.m03395 phosphatase-related low similarity to phosphoprotein phosphatase [Mus musculus] GI:567040; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 350 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 262 EFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVDPT 417 +F+ + KA+++ P + R+QA+ LE F EA DA +DP+ Sbjct: 17 DFDVAVDLYSKAIDLDPNCAEFFADRAQAYIKLESFTEAVADANKAIELDPS 68 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = +2 Query: 104 AESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLR 256 A+ +K +AF +++ A+ Y+KAI+L + A + +RA AY++ Sbjct: 2 AKELADKAKEAFVDDDFDVAVDLYSKAIDL----DPNCAEFFADRAQAYIK 48 >At4g11655.1 68417.m01863 transmembrane protein, putative contains 4 transmembrane spanning domains, PMID:11152613 Length = 208 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -2 Query: 426 SFVSWVHSKYCFGISV-GF-FKSLQTFKSL 343 SF S+ YCFG++V GF + SLQTFK + Sbjct: 92 SFASYPELLYCFGVAVIGFVYTSLQTFKGV 121 >At3g09240.1 68416.m01098 protein kinase-related low similarity to protein kinase GI:166809; contains Pfam profile: Eukaryotic protein kinase domain Length = 477 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 +E YK G+ AF++++++ AI FYT+ ++ A S T L R YL Sbjct: 374 QENMDYKKHGDAAFRAKDFETAIEFYTEFMSGAPVVS---PTVLARRCLCYL 422 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 31.1 bits (67), Expect = 0.88 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +1 Query: 250 LKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIFTVD 411 +K K+ I D + ALEI P+ K R A L + EA +D T+D Sbjct: 168 IKLKKPNAAIRDANAALEINPDSAKGYKSRGMARAMLGEWAEAAKDLHLASTID 221 >At5g46570.1 68418.m05734 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 489 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +2 Query: 77 DYTMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 ++T VQE + K G+ AF+ ++++ +I +Y+K + + S AT RA +YL Sbjct: 373 EWTQQVQEMLNT-KKFGDIAFRDKDFKNSIEYYSKLVGMMPVPS---ATVFARRAFSYL 427 >At2g15790.1 68415.m01810 peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase identical to cyclophilin-40 [Arabidopsis thaliana] GI:13442983; supporting cDNA gi|13442982|gb|AY026065.1| Length = 361 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/70 (24%), Positives = 31/70 (44%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAFECLERFEEAYRDAKTIF 402 IF S LK + + + D + A+ + KALFR+ QA+ L + A + Sbjct: 266 IFTNSAACKLKFGDAKGALLDTEFAMRDEDNNVKALFRQGQAYMALNNVDAAAESLEKAL 325 Query: 403 TVDPTNKAVQ 432 +P + ++ Sbjct: 326 QFEPNDAGIK 335 >At1g24330.1 68414.m03069 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 771 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 537 EDIEKREKAMANLLVLAKENSGAEVML-KNGVVQRIQQLLK 656 ED+ K+ K + N+ +L K+N A +++ NG V+ Q L+ Sbjct: 436 EDLAKKCKVVENVRILLKDNEEARILMGANGFVEAFLQFLE 476 >At4g00710.1 68417.m00097 protein kinase family protein low similarity to protein kinase [Arabidopsis thaliana] GI:2852449; contains Pfam profile: PF00069 Protein kinase domain Length = 489 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 80 YTMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAIN 190 +T +QE S K KG+ AF+ ++++EAI YT+ I+ Sbjct: 374 WTDQMQESLNS-KKKGDVAFRQKDFREAIECYTQFID 409 >At5g42340.1 68418.m05155 armadillo/beta-catenin repeat family protein / U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200, GI:14582198; contains Pfam profiles PF04564: U-box domain, PF00514: Armadillo/beta-catenin-like repeat Length = 656 Score = 29.1 bits (62), Expect = 3.6 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 6/102 (5%) Frame = +3 Query: 474 SPKCSNKQ*SGTMFKLAFGLGEDIEKREKAMANLLVLAKENSGAEVMLKN-GVVQRIQQL 650 SP N+Q + +E++ +++ + +LA+EN V++ N G + + QL Sbjct: 366 SPDSQNEQKDEVSLLVEALSSSQLEEQRRSVKQMRLLARENPENRVLIANAGAIPLLVQL 425 Query: 651 LKVEKNSEIYINAIRV-----IGQICKKNIERTRAVLKVVGI 761 L +S I NA+ I ++ KK I A+ ++ I Sbjct: 426 LSY-PDSGIQENAVTTLLNLSIDEVNKKLISNEGAIPNIIEI 466 >At5g10090.1 68418.m01169 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 594 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +2 Query: 116 KNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAA 244 +++GND FK+ +QEA T Y + + + SR+ + L NRAA Sbjct: 475 RSRGNDFFKAGRFQEACTAYGEGL---DHDSRN-SVLLCNRAA 513 >At5g03860.1 68418.m00358 malate synthase, putative strong similarity to glyoxysomal malate synthase from Brassica napus [SP|P13244] Length = 562 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 89 VVQEEAESY-KNKGNDAFKSENYQEAITFYTKAINLAE 199 VV+EE E K G D FK+ Y+EA +TK E Sbjct: 501 VVEEEMERIEKEVGKDKFKNGMYKEACKMFTKQCTAPE 538 >At5g03360.1 68418.m00289 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 1610 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 205 QPRPCNIFKKSGRSLLKTKEFEKVISDCDKAL 300 + R C++ KK LL TKE I +CD AL Sbjct: 547 EARLCSVCKKESWLLLSTKETFNCIEECDFAL 578 >At5g01060.1 68418.m00009 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 499 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +2 Query: 98 EEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 +E YK G+ AF ++++ AI FYT+ + A S T L R YL Sbjct: 396 QENMDYKKHGDAAFLAKDFDTAIEFYTEFMTGAPTVS---PTVLARRCLCYL 444 >At3g50030.1 68416.m05470 hypothetical protein Length = 501 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +1 Query: 223 IFKKSGRSLLKTKEFEKVISDCDKALEIIP-EDP--KALFRRSQAFECLERFEEAYRD 387 +F + L K+ E ISD +AL + +P K+L+RRSQAF+ E+ D Sbjct: 401 LFSNRAQCYLLLKKVESAISDATRALCLSGVNNPHGKSLWRRSQAFDLKGSTRESLMD 458 >At5g41260.1 68418.m05015 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 487 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 113 YKNKGNDAFKSENYQEAITFYTKAINLAEKGS 208 +K KG+ AF+ +++ +AI Y++ I + GS Sbjct: 385 FKKKGDSAFRHKDFAKAIECYSQFIEVGTMGS 416 >At3g56210.1 68416.m06247 expressed protein Length = 191 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/66 (21%), Positives = 34/66 (51%) Frame = +3 Query: 528 GLGEDIEKREKAMANLLVLAKENSGAEVMLKNGVVQRIQQLLKVEKNSEIYINAIRVIGQ 707 G +D + R++A+ L L+K A+ + NG + ++ ++S+I ++ + Sbjct: 121 GSAKDDKTRKEALKALAALSKSGEAAKFLGSNGALSIVKSTPNSLEDSDISTYKSNILEK 180 Query: 708 ICKKNI 725 + +KN+ Sbjct: 181 LVEKNL 186 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = +2 Query: 95 QEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRPK 262 +++A+S K+K +A + EAI TKA+ L + AT RA+ +L+ K Sbjct: 109 RDDAQSEKSKAMEAISDGRFDEAIEHLTKAVMLNPTSAILYAT----RASVFLKVK 160 >At5g59010.1 68418.m07392 protein kinase-related low similarity to serine/threonine/tyrosine-specific protein kinase APK1, Arabidopsis thaliana, SP|Q06548 PIR:S28615; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 489 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +2 Query: 80 YTMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYL 253 +T +QE S K +G+ AFK +++ A+ YT+ I E G+ T R YL Sbjct: 375 WTDQIQETLNS-KKQGDAAFKGKDFVTAVECYTQFI---EDGTMVSPTVFARRCLCYL 428 >At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 883 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 274 VISDCDKALEIIPEDPKALFRRSQAFECLERFEEA 378 VI DCDKAL + P +A + +A L R +EA Sbjct: 58 VIKDCDKALLLEPFAIQAFILKGRALLALGRKQEA 92 >At3g54030.1 68416.m05974 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 490 Score = 27.9 bits (59), Expect = 8.2 Identities = 19/65 (29%), Positives = 35/65 (53%) Frame = +2 Query: 80 YTMVVQEEAESYKNKGNDAFKSENYQEAITFYTKAINLAEKGSRDLATYLKNRAAAYLRP 259 +T +QE S K +G+ AF+S+++ A+ YT+ I + G+ T R +YL Sbjct: 377 WTNQMQESLNS-KKQGDLAFRSKDFTTAVDCYTQFI---DGGTMVSPTVHARRCLSYLMN 432 Query: 260 KNSKK 274 N+++ Sbjct: 433 DNAQE 437 >At2g33360.1 68415.m04089 expressed protein Length = 603 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 232 KSGRSLLKTKEFEKVISDCDKALEIIPEDPKALFRRSQAF 351 KSG L + ++ ++S+ K L+I+ PK F R+ +F Sbjct: 33 KSGNLLSQKRQQCSLVSNSGKWLQIVKNGPKGSFSRATSF 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,580,514 Number of Sequences: 28952 Number of extensions: 309748 Number of successful extensions: 1059 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -