BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30774 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical prote... 26 0.95 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 25 2.9 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 8.8 >AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical protein protein. Length = 135 Score = 26.2 bits (55), Expect = 0.95 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = +2 Query: 452 AGCSGFVSV-GGLDSDGFA 505 AGCSG+VS GG +SD F+ Sbjct: 65 AGCSGYVSPRGGTNSDDFS 83 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 24.6 bits (51), Expect = 2.9 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%) Frame = +2 Query: 440 NGPAAGCSGFVSVGGLDSDGFAML-------ERHSRLRSYWSLQRV 556 +GP++ SG SVGG S AML ++H+RL S L V Sbjct: 220 SGPSSWMSGAGSVGGPSSAAAAMLSASSGGQQQHARLSSSLPLSSV 265 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 209 RRNQGIHRRKTGRGKRERNNSRKQ 138 R+N G+ + TGRG+ +SR++ Sbjct: 182 RKNHGLFVQVTGRGRGPPGHSRQR 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,425 Number of Sequences: 2352 Number of extensions: 10126 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -