BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30774 (675 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC112159-1|AAI12160.1| 432|Homo sapiens phosphoprotein associat... 31 3.7 BC090931-1|AAH90931.1| 432|Homo sapiens phosphoprotein associat... 31 3.7 AK000680-1|BAA91321.1| 432|Homo sapiens protein ( Homo sapiens ... 31 3.7 AF240634-1|AAF67343.1| 432|Homo sapiens phosphoprotein associat... 31 3.7 L12350-1|AAA03703.1| 1172|Homo sapiens thrombospondin 2 protein. 31 4.9 BX322234-1|CAI23645.1| 1172|Homo sapiens thrombospondin 2 protein. 31 4.9 BC150175-1|AAI50176.1| 1172|Homo sapiens thrombospondin 2 protein. 31 4.9 BC146676-1|AAI46677.1| 1172|Homo sapiens thrombospondin 2 protein. 31 4.9 >BC112159-1|AAI12160.1| 432|Homo sapiens phosphoprotein associated with glycosphingolipid microdomains 1 protein. Length = 432 Score = 31.1 bits (67), Expect = 3.7 Identities = 17/74 (22%), Positives = 34/74 (45%) Frame = -1 Query: 534 DRSRECRSSIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPV 355 DR+++CR S+ S + + E P P+K + EN + + G ++ T + Sbjct: 231 DRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSET 290 Query: 354 KPRDSEVVEETKSE 313 R S + +++ E Sbjct: 291 NKRFSSLSYKSREE 304 >BC090931-1|AAH90931.1| 432|Homo sapiens phosphoprotein associated with glycosphingolipid microdomains 1 protein. Length = 432 Score = 31.1 bits (67), Expect = 3.7 Identities = 17/74 (22%), Positives = 34/74 (45%) Frame = -1 Query: 534 DRSRECRSSIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPV 355 DR+++CR S+ S + + E P P+K + EN + + G ++ T + Sbjct: 231 DRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSET 290 Query: 354 KPRDSEVVEETKSE 313 R S + +++ E Sbjct: 291 NKRFSSLSYKSREE 304 >AK000680-1|BAA91321.1| 432|Homo sapiens protein ( Homo sapiens cDNA FLJ20673 fis, clone KAIA4464. ). Length = 432 Score = 31.1 bits (67), Expect = 3.7 Identities = 17/74 (22%), Positives = 34/74 (45%) Frame = -1 Query: 534 DRSRECRSSIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPV 355 DR+++CR S+ S + + E P P+K + EN + + G ++ T + Sbjct: 231 DRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSET 290 Query: 354 KPRDSEVVEETKSE 313 R S + +++ E Sbjct: 291 NKRFSSLSYKSREE 304 >AF240634-1|AAF67343.1| 432|Homo sapiens phosphoprotein associated with GEMs protein. Length = 432 Score = 31.1 bits (67), Expect = 3.7 Identities = 17/74 (22%), Positives = 34/74 (45%) Frame = -1 Query: 534 DRSRECRSSIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVNNPV 355 DR+++CR S+ S + + E P P+K + EN + + G ++ T + Sbjct: 231 DRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSET 290 Query: 354 KPRDSEVVEETKSE 313 R S + +++ E Sbjct: 291 NKRFSSLSYKSREE 304 >L12350-1|AAA03703.1| 1172|Homo sapiens thrombospondin 2 protein. Length = 1172 Score = 30.7 bits (66), Expect = 4.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 477 WADWTQMVSQCWSGTRDSGRT 539 WA+WTQ C SGT+ GR+ Sbjct: 387 WAEWTQCSVTCGSGTQQRGRS 407 >BX322234-1|CAI23645.1| 1172|Homo sapiens thrombospondin 2 protein. Length = 1172 Score = 30.7 bits (66), Expect = 4.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 477 WADWTQMVSQCWSGTRDSGRT 539 WA+WTQ C SGT+ GR+ Sbjct: 387 WAEWTQCSVTCGSGTQQRGRS 407 >BC150175-1|AAI50176.1| 1172|Homo sapiens thrombospondin 2 protein. Length = 1172 Score = 30.7 bits (66), Expect = 4.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 477 WADWTQMVSQCWSGTRDSGRT 539 WA+WTQ C SGT+ GR+ Sbjct: 387 WAEWTQCSVTCGSGTQQRGRS 407 >BC146676-1|AAI46677.1| 1172|Homo sapiens thrombospondin 2 protein. Length = 1172 Score = 30.7 bits (66), Expect = 4.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 477 WADWTQMVSQCWSGTRDSGRT 539 WA+WTQ C SGT+ GR+ Sbjct: 387 WAEWTQCSVTCGSGTQQRGRS 407 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,811,505 Number of Sequences: 237096 Number of extensions: 1669110 Number of successful extensions: 5631 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5626 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -