BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30774 (675 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3816|AAF47165.3| 1669|Drosophila melanogaster CG4049-PA... 31 1.1 U19909-2|AAB02544.1| 945|Drosophila melanogaster corkscrew prot... 29 7.7 AY135134-2|AAN17642.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135133-2|AAN17640.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135132-2|AAN17638.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135129-2|AAN17632.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135126-2|AAN17626.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135125-2|AAN17624.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135124-2|AAN17622.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135123-2|AAN17620.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135122-2|AAN17618.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135121-2|AAN17616.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135120-2|AAN17614.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135119-2|AAN17612.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AY135118-2|AAN17610.1| 945|Drosophila melanogaster corkscrew ph... 29 7.7 AL132797-3|CAB65871.1| 945|Drosophila melanogaster EG:BACN25G24... 29 7.7 AE014298-335|AAF45725.1| 945|Drosophila melanogaster CG3954-PB,... 29 7.7 >AE013599-3816|AAF47165.3| 1669|Drosophila melanogaster CG4049-PA protein. Length = 1669 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/79 (26%), Positives = 33/79 (41%) Frame = -1 Query: 543 DQYDRSRECRSSIAKPSESNPPTETKPEQPAAGPLKQIFENSPVLQGIAGAVKKIQTTVN 364 D D + + + K ESNP T ++PE PA ++ EN + + TT N Sbjct: 1422 DVKDLTADDEPRVVKNKESNPATTSRPEMPAKD--RKSTENVQHFKSQTQPNTTLATTTN 1479 Query: 363 NPVKPRDSEVVEETKSEQE 307 P D + +S Q+ Sbjct: 1480 QHQLPSDLTYSQPQQSHQQ 1498 >U19909-2|AAB02544.1| 945|Drosophila melanogaster corkscrew protein 4A protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135134-2|AAN17642.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135133-2|AAN17640.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135132-2|AAN17638.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135129-2|AAN17632.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135126-2|AAN17626.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135125-2|AAN17624.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135124-2|AAN17622.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135123-2|AAN17620.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135122-2|AAN17618.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135121-2|AAN17616.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135120-2|AAN17614.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135119-2|AAN17612.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AY135118-2|AAN17610.1| 945|Drosophila melanogaster corkscrew phosphatase splice variantB protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AL132797-3|CAB65871.1| 945|Drosophila melanogaster EG:BACN25G24.2,FBgn0000382;csw protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 >AE014298-335|AAF45725.1| 945|Drosophila melanogaster CG3954-PB, isoform B protein. Length = 945 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 552 R*SDQYDRSRECRSSIAKPSESNPPTET-KPEQPAAGPLKQIFENSPVLQGIA 397 R S++ +RS + ++S + ++ PPTET + ++PA E + +++G+A Sbjct: 68 RRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA 120 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,136,885 Number of Sequences: 53049 Number of extensions: 464380 Number of successful extensions: 2013 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2011 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2930645700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -