BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30773 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 2.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 5.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.3 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 52 PCGYEIRSDAVVSLGHFHIPIDLLTITSRRSENRSFSA 165 PC Y V+SLG F + + L T E+ S ++ Sbjct: 33 PCVYLTSFSVVLSLGSFIVSVYLTTKIDNDGESISLAS 70 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 202 SISSGIHRNSFNFFVSKRYNISKNLENMEI 291 ++ G++RN NF + + L+N+EI Sbjct: 566 TLKIGVYRNIKNFNIPSILQFNDGLKNLEI 595 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +3 Query: 495 RQTLAWRRASPVGPG----ARPSSSTSRAED 575 R + W+RA+ V PG +P++ + ED Sbjct: 727 RPVVTWKRATGVSPGDYKDFKPNNPDIKVED 757 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 176 TKETCDIFLV*VPVFIGTVLIFSY 247 TK+ I L+ VF+ T L+F Y Sbjct: 484 TKQQSKIHLIVRSVFVTTYLMFDY 507 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 261 IVPFRYEKIKTVPMNTGTYTRKISQVSF 178 I+ F Y+ IKT+ + + RK +SF Sbjct: 130 IIAFYYKPIKTLNGHEIKFIRKEEYISF 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,859 Number of Sequences: 336 Number of extensions: 2314 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -