BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30773 (697 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 25 7.8 SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 25 7.8 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -2 Query: 291 DLHVFQIFTYIVPFRYEKIKTVPMNTGTYTRKI-SQVSFVLLIRTERP 151 D H+ IFT PF ++ T T ++ Q+ +L +R + P Sbjct: 523 DAHINSIFTLAEPFAFDAPDVYDFGDQTITARVKQQIPVMLDLRLQPP 570 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 25.4 bits (53), Expect = 7.8 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -2 Query: 276 QIFTYIVPFRYEKIKTVPMNTGTYTRKISQVSFVLLIRTERPVFGPATSYRQEI 115 Q FT V +V +N+ T T SQ+S + + + PVF P+ S ++ Sbjct: 127 QAFTSTVDISSSTSSSV-INSPTGTAVSSQISTLSMSPSSTPVFSPSASVSSKV 179 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,330,824 Number of Sequences: 5004 Number of extensions: 39741 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -