BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30771X (503 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1026 + 30214437-30214937 130 8e-31 02_05_0416 + 28791512-28792012 130 8e-31 09_06_0123 - 20997498-20997512,20998015-20998100,20999066-209991... 30 1.2 09_02_0178 + 5399982-5400048,5400421-5400518 30 1.2 03_06_0776 - 36176390-36177589 29 2.8 09_02_0591 - 10997771-10998054,10998671-10999017,10999088-109992... 28 4.9 09_03_0023 + 11617562-11617692,11617773-11617844,11620438-116205... 27 6.5 07_03_0313 + 16620817-16621515 27 6.5 04_04_1551 - 34348110-34348225,34348468-34348606,34348658-343488... 27 6.5 02_05_0528 - 29782382-29782864,29782994-29783092,29783319-297833... 27 6.5 11_06_0546 + 24853167-24853880 27 8.6 11_01_0669 - 5454116-5454153,5454569-5454770,5454865-5455029,545... 27 8.6 07_01_1116 + 10308029-10308111,10308575-10308737,10308996-103090... 27 8.6 07_01_0292 - 2117212-2117326,2117402-2117527,2117654-2117791,211... 27 8.6 04_04_1574 - 34536744-34537136,34541247-34541405,34541497-345424... 27 8.6 03_01_0319 - 2499470-2499598,2499681-2499746,2499830-2499937,250... 27 8.6 >04_04_1026 + 30214437-30214937 Length = 166 Score = 130 bits (313), Expect = 8e-31 Identities = 61/84 (72%), Positives = 75/84 (89%), Gaps = 1/84 (1%) Frame = +3 Query: 6 DPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKITVQLTV 182 DP ++ V +R GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++TV+LTV Sbjct: 6 DPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTV 65 Query: 183 QNRQAQIAVVPSAAALIIRALKEP 254 QNRQA+++VVPSAAAL+I+ALKEP Sbjct: 66 QNRQAKVSVVPSAAALVIKALKEP 89 Score = 100 bits (240), Expect = 6e-22 Identities = 47/69 (68%), Positives = 57/69 (82%) Frame = +2 Query: 257 RDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLCGSVKEILSTAQSVGCTVEGRPPH 436 RDRKK KNIKH+GNISL+DVI IA+IMRNRSMA+ + G+VKEIL T SVGCTV+G+ P Sbjct: 91 RDRKKVKNIKHSGNISLDDVIEIARIMRNRSMAKEMAGTVKEILGTCVSVGCTVDGKDPK 150 Query: 437 DLIDDINSG 463 DL +I+ G Sbjct: 151 DLQQEISDG 159 >02_05_0416 + 28791512-28792012 Length = 166 Score = 130 bits (313), Expect = 8e-31 Identities = 61/84 (72%), Positives = 75/84 (89%), Gaps = 1/84 (1%) Frame = +3 Query: 6 DPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATS-DWKGLKITVQLTV 182 DP ++ V +R GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T+ DWKGL++TV+LTV Sbjct: 6 DPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTV 65 Query: 183 QNRQAQIAVVPSAAALIIRALKEP 254 QNRQA+++VVPSAAAL+I+ALKEP Sbjct: 66 QNRQAKVSVVPSAAALVIKALKEP 89 Score = 97.1 bits (231), Expect = 7e-21 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = +2 Query: 257 RDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLCGSVKEILSTAQSVGCTVEGRPPH 436 RDRKK KNIKH+GNISL+DVI IA++MR RSMA+ + G+VKEIL T SVGCTV+G+ P Sbjct: 91 RDRKKVKNIKHSGNISLDDVIEIARVMRPRSMAKEMAGTVKEILGTCVSVGCTVDGKDPK 150 Query: 437 DLIDDINSG 463 DL +I+ G Sbjct: 151 DLQQEISDG 159 >09_06_0123 - 20997498-20997512,20998015-20998100,20999066-20999198, 20999264-20999341,21000130-21000216,21001164-21001254, 21001338-21001488,21001567-21002296,21002404-21002820 Length = 595 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 3/93 (3%) Frame = +3 Query: 42 VGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITVQLTVQNRQAQIAVVPSA 221 +GG G+ +LA G PK D K+ SD + L V + Q P + Sbjct: 98 MGGGPGSWPALAESAAARGSWPKSASSDSLKSLSDGSAPSASEDLIVPSVQPHPVANPIS 157 Query: 222 AALIIRALKEP---LVIVKSRKISNTTATSPLR 311 + P V+V S + NT ++P+R Sbjct: 158 GGSNPTSSPPPPNATVVVTSEQNGNTDQSNPVR 190 >09_02_0178 + 5399982-5400048,5400421-5400518 Length = 54 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 317 LHPQGRCCRCV*YFSA--FYDHERLLKGSDDKGCCRGNN 207 +HPQG CRC YF + GSDD+ CC NN Sbjct: 19 IHPQG--CRCC-YFRLRPMIQCAKACCGSDDENCCLVNN 54 >03_06_0776 - 36176390-36177589 Length = 399 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 272 QKNIKHNGNISLEDVIGIAKIMRNRSMARY 361 +K+I++ G++ LE + K+M +RSM RY Sbjct: 113 EKSIQNIGSLELERNAAVEKLMSSRSMHRY 142 >09_02_0591 - 10997771-10998054,10998671-10999017,10999088-10999247, 10999333-10999401,11000256-11000382,11000759-11001021, 11001122-11001279,11001390-11001464,11002876-11002947, 11003039-11003177,11003275-11003744,11003907-11003935 Length = 730 Score = 27.9 bits (59), Expect = 4.9 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +3 Query: 183 QNRQAQIAVVPSAAALIIRALKEPLVIVKSRKISNTTATSPLRM*SELRRS*G--TDQWR 356 +NR +AV A L++ L +I ++++ NT++T L M ELR + G T+ W Sbjct: 280 RNRAVTLAVSVVAPVLVLAILVLTYLIWRAKRKLNTSSTD-LAMVPELRGAPGHITNHWD 338 Query: 357 GIFVAQ*KRFLAQ 395 + + +RF Q Sbjct: 339 HLQEPENRRFTYQ 351 >09_03_0023 + 11617562-11617692,11617773-11617844,11620438-11620595, 11620677-11620939,11621041-11621167,11621748-11621816, 11621931-11622120,11622309-11622672 Length = 457 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +3 Query: 165 TVQLT-VQNRQAQIAVVPSAAALIIRALKEPLVIVKSRKISNTTATSPLRM 314 T LT +NR A +A+ +A L++ AL ++ K+++ NT+A +P R+ Sbjct: 79 TTSLTRSKNRAAILAISVAAPMLVVIALFVGYLMWKAKRKPNTSAYNPPRV 129 >07_03_0313 + 16620817-16621515 Length = 232 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -2 Query: 154 PFQSLVALAMSSPTFLGDRPRGPILGAKDDVAPTSPPTHRKFTILI 17 PF +A++ D +LGAK D+ S P H K +L+ Sbjct: 15 PFGQRCRIALAEKKLPYDYSEQELLGAKSDLLLRSNPIHAKVPVLL 60 >04_04_1551 - 34348110-34348225,34348468-34348606,34348658-34348896, 34349042-34349140,34349207-34350188,34350737-34350832, 34350936-34351064,34351253-34351332,34351420-34351661, 34351743-34352692 Length = 1023 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +3 Query: 30 NLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIA 131 N +C G E G S AP++ PLG+ PK G+ IA Sbjct: 736 NSKCAGAE-GINS--APRVTPLGIRPKG-GESIA 765 >02_05_0528 - 29782382-29782864,29782994-29783092,29783319-29783387, 29783781-29783888,29783965-29784274,29784772-29784812, 29784886-29784942,29785290-29785448,29785587-29785655, 29785728-29785877,29785967-29786098,29786347-29786433, 29786516-29786686,29786760-29786960,29787348-29787416, 29787510-29787618,29787887-29788005,29788676-29788780, 29789377-29789755,29790022-29790150,29790223-29790402, 29791310-29791469,29791604-29791744,29791832-29792021, 29792100-29792161,29792879-29793107 Length = 1335 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -2 Query: 103 DRPRGPILGAKDDVAPTSPPTHRKFTILISFGSN 2 D GP G DD + T P H + T I F N Sbjct: 646 DEDSGPRPGTSDDSSATKPAEHNESTAEILFNPN 679 >11_06_0546 + 24853167-24853880 Length = 237 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -3 Query: 489 KHLFINGQTPLLMSSIRSCGGLPS-TVHPT--DCAVLRISFTEPQ 364 KHL +NG LL+SS+ + + T+H T D A L+I +P+ Sbjct: 38 KHLELNGNKSLLLSSLENAKNISKVTLHSTWLDRANLQILAKKPR 82 >11_01_0669 - 5454116-5454153,5454569-5454770,5454865-5455029, 5455278-5456183 Length = 436 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 3 FDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKV 116 F N +KIV ++C G EV +G G+ +K+ Sbjct: 375 FVSNHLKIVEIKCKGKEVMWVCKFLKTLGTFGIPLEKI 412 >07_01_1116 + 10308029-10308111,10308575-10308737,10308996-10309062, 10309120-10309375,10309658-10309781,10310039-10310077 Length = 243 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 233 DKGCCRGNNSYLGL-SVLNCQLHSD 162 D GCC SYLGL +L C++++D Sbjct: 62 DCGCCYALPSYLGLFHILICKVYAD 86 >07_01_0292 - 2117212-2117326,2117402-2117527,2117654-2117791, 2117904-2118323,2118421-2118591,2118701-2118880, 2118988-2119140,2119226-2119384,2119841-2120152, 2120285-2120452,2120851-2121050,2122207-2122589, 2123244-2123625 Length = 968 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 284 KHNGNISLEDVIGIAKIMRNRSMARYLCGSVKEILSTAQSVG 409 K + + L D + +I + +AR+LC SVK + + QS G Sbjct: 902 KFSTSTRLADCMSFGRINGSSRVARHLCVSVKPLSNMIQSNG 943 >04_04_1574 - 34536744-34537136,34541247-34541405,34541497-34542411, 34543642-34543731,34544324-34544390,34544483-34544676, 34544770-34545510,34545596-34545661,34545783-34545908, 34545978-34546073,34546153-34546521,34546602-34546724, 34546802-34546906,34547394-34547531,34547665-34547760, 34548018-34548275 Length = 1311 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -3 Query: 141 LWPWQCHHPPF*ETDQEDRF*GPKMMWHRLPRRHIA 34 +W C H P+ E D E R GP L R I+ Sbjct: 1182 MWMLNCRHQPYREEDGELRIVGPPHQHAHLKRVRIS 1217 >03_01_0319 - 2499470-2499598,2499681-2499746,2499830-2499937, 2500125-2500259,2500763-2500840,2500994-2501044, 2501805-2501879,2501975-2502037,2503048-2503137, 2503215-2503406,2503498-2503591,2503776-2504279, 2504415-2504614,2504712-2504756,2505023-2505082, 2505476-2505520,2505858-2505941,2506121-2506318, 2506960-2507667 Length = 974 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +2 Query: 233 HQSP*GASRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLCG 370 H S G D +++ N+K + E V+G AK+ N + + +CG Sbjct: 614 HSSVKGVGSDEEEELNMKQEIVVDDEKVMGWAKVHNNEPL-QIVCG 658 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,772,068 Number of Sequences: 37544 Number of extensions: 310057 Number of successful extensions: 831 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -