BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30771X (503 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 25 1.1 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 1.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 1.1 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 24 3.4 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 5.9 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 5.9 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 5.9 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 7.8 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 25.4 bits (53), Expect = 1.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 337 EEQINGAVSLWLSKRDS*HSTVSWMYCG 420 E + GAV+LWL R + H Y G Sbjct: 230 EINVTGAVNLWLKNRQANHGLYIGAYFG 257 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 171 QLTVQNRQAQIAVVPSAAALIIRALKEP 254 QL + RQ ++AV PS+ L A K P Sbjct: 1610 QLLERTRQKRMAVCPSSVVLAREAFKHP 1637 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 1.1 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 157 RPFQSLVAL--AMSSPTFLGDRPRGPILGAKDDVAPTSPPTHRKFTILISFG 8 RPF S+ L +S+P LG RP+G LG P+ P H + + G Sbjct: 548 RPFFSIPGLPPGLSAPLGLGMRPQGGPLG-----LPSHHPLHPSLGLSMGLG 594 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +2 Query: 362 LCGSVKEILSTAQSVGCTVEGRPPHDLIDDINSGV 466 LC +++V T+ G PH L+D++ + Sbjct: 60 LCNRFNGFRKKSENVLMTLAGPEPHQLLDELERDI 94 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 362 DTAPLICSS*SSQFRLHPQGRCC 294 DT PL+C+S S + P C Sbjct: 601 DTIPLLCASNSGSTVISPNATVC 623 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 99 LSPKKVGDDIAKATSDW 149 L PKK+ D AK DW Sbjct: 200 LPPKKIKDPEAKKPEDW 216 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 381 SFTEPQRYRAIDLFLMIFAIPITSSREMLP 292 +F P+R AIDL + ++ T+ E+LP Sbjct: 165 TFVTPERKSAIDLTFVSQSLMETTGWEVLP 194 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 105 PKKVGDDIAKATSDWKGLKIT 167 PKK+ D++A D G+K+T Sbjct: 387 PKKLDDEVAALHLDKLGVKLT 407 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,883 Number of Sequences: 2352 Number of extensions: 10785 Number of successful extensions: 19 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -