BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30758 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 25 7.5 SPCC320.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 25 7.5 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 25 7.5 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.4 bits (53), Expect = 7.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 39 RKALLLHGSWC 7 +K LL+HGSWC Sbjct: 949 KKLLLVHGSWC 959 >SPCC320.06 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 289 Score = 25.4 bits (53), Expect = 7.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 486 LLFS*RIIEIWSQGNLDIRPCGSDTKWRYLVKTIDLAN 599 L S R I + S ++ R CGSD + VK+ID N Sbjct: 24 LTLSTRRINLQSFQSISARNCGSDARVLDFVKSIDNDN 61 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.4 bits (53), Expect = 7.5 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +3 Query: 507 IEIWSQGNLDIRPCGSDTKWRYLVKTIDL 593 +E + GN + CG ++ W Y + +D+ Sbjct: 1496 VEYFIMGNPNQNACGEESYWYYRITFVDM 1524 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,847,010 Number of Sequences: 5004 Number of extensions: 57351 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -