BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30757 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 27 0.20 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 3.3 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 22 4.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 5.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.8 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 7.7 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 26.6 bits (56), Expect = 0.20 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 350 RCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSP 445 R R VVPP C P+T+ P P D++ P Sbjct: 195 RSLRCVVPPTEDCDVPSTIPPPPPEEDDDSNIP 227 Score = 23.8 bits (49), Expect = 1.4 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +3 Query: 201 TMSCVSPPRNTQSCSLRLPQPQGQQREDDPDHV--RNIQHARHVRRHPSRALAV 356 ++ CV PP T+ C + P EDD ++ N ++ +H P A+ V Sbjct: 196 SLRCVVPP--TEDCDVPSTIPPPPPEEDDDSNIPQNNPKNKQHNFNLPPGAIPV 247 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 267 GQQREDDPDHVRNIQHARHVRRHPSRA 347 GQ DP+ V + H+ HP +A Sbjct: 903 GQYTTKDPNEVTCDEEEGHISYHPDKA 929 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 120 PDPQIPHRTRNRH 158 PD +P RT NRH Sbjct: 110 PDNFLPERTANRH 122 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASS 172 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 83 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 128 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 317 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 454 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 483 HRLPHEDPHERGYSFTTTAERN 548 H + H+DPH ++ T T +N Sbjct: 439 HPVYHKDPHYGFHNVTNTTLQN 460 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,303 Number of Sequences: 336 Number of extensions: 4510 Number of successful extensions: 21 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -