BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30733 (462 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.8 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 7.4 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.4 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 20 9.7 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 1.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 302 SAPLTTVWLPSPYNKW 349 SA + TVW+ S N+W Sbjct: 448 SAYVATVWINSVINRW 463 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 20.6 bits (41), Expect = 7.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 223 LTGRLNKCGVIHLV 264 L RLN GVIHLV Sbjct: 421 LLKRLNGRGVIHLV 434 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 225 HRQTKQVWCHSPRFDVPIND 284 +RQ +Q W +S R + ND Sbjct: 177 YRQNQQRWQNSIRHSLSFND 196 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 20.2 bits (40), Expect = 9.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -1 Query: 198 VIINDFKLSDVTVLHHHC*KLNDDFGTGPDEDLSFPSLF 82 V N KL T+ H H L+ + PD + P F Sbjct: 91 VTCNGLKLPKSTITHLHIYDLHHNPDIYPDPEKFDPERF 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,095 Number of Sequences: 336 Number of extensions: 1910 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -