BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30732 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 25 3.0 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 24 4.0 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -2 Query: 203 LVVQH--LSVLRIHRGPSRKVDELCHMP 126 LVV H VL H G S VDE C +P Sbjct: 19 LVVAHPGKDVLGCHNGTSITVDECCAIP 46 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 292 ILASHETMAEILGVSPVELKEGFHLDIEDY 381 + A H T+A+I + + E F D+E Y Sbjct: 146 VAADHLTLADIFMLGSITALEWFRYDLERY 175 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,324 Number of Sequences: 2352 Number of extensions: 15411 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -