BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30730 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 25 0.94 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 8.8 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 8.8 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 24.6 bits (51), Expect = 0.94 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 5/82 (6%) Frame = +3 Query: 24 LKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGG-----ITAGV 188 + RK+G +V + N GL +K + ++ TE K E + G + Sbjct: 29 MTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTEIKFKLGEEFEEETVDGRKVKSVCTLD 88 Query: 189 SSKLGQMRNSESFRSIEERVGS 254 +KL Q++ E +IE S Sbjct: 89 GNKLIQVQKGEKQTTIEREFSS 110 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 473 VELPASRGRARYGRGDIAN 417 V +P +G Y RG++AN Sbjct: 61 VRIPKEQGFLSYWRGNLAN 79 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 473 VELPASRGRARYGRGDIAN 417 V +P +G Y RG++AN Sbjct: 61 VRIPKEQGFLSYWRGNLAN 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,476 Number of Sequences: 438 Number of extensions: 4696 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -