BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30727 (693 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 85 6e-17 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 79 3e-15 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 79 3e-15 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 79 3e-15 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 67 9e-12 At1g66260.1 68414.m07522 RNA and export factor-binding protein, ... 65 4e-11 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 48 4e-06 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 44 1e-04 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 44 1e-04 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 44 1e-04 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 42 5e-04 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 42 5e-04 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 42 5e-04 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 41 9e-04 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 41 9e-04 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 40 0.002 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 40 0.002 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 39 0.003 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 38 0.008 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 37 0.011 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 37 0.011 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 37 0.011 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 37 0.011 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 35 0.059 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 35 0.059 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 35 0.059 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.10 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 34 0.10 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 34 0.10 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 34 0.10 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 34 0.10 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 33 0.14 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 33 0.18 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 33 0.18 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 32 0.31 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 32 0.31 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 32 0.31 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 32 0.31 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 32 0.31 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 32 0.31 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 32 0.31 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 32 0.41 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 32 0.41 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 32 0.41 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 31 0.55 At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ... 31 0.73 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 31 0.96 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 31 0.96 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 30 1.3 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 30 1.3 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 30 1.7 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 30 1.7 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 30 1.7 At1g05020.1 68414.m00503 epsin N-terminal homology (ENTH) domain... 30 1.7 At4g27330.1 68417.m03921 sporocyteless (SPL) identical to sporoc... 29 2.2 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 29 2.2 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 29 2.2 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 29 2.2 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 29 2.9 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 29 3.9 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 29 3.9 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 29 3.9 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 29 3.9 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 28 5.1 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 28 5.1 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 28 5.1 At5g24910.1 68418.m02949 cytochrome P450 family protein similar ... 28 5.1 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 28 5.1 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 28 5.1 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 28 5.1 At4g17720.1 68417.m02646 RNA recognition motif (RRM)-containing ... 28 6.8 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 28 6.8 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 28 6.8 At1g51460.1 68414.m05792 ABC transporter family protein similar ... 28 6.8 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 27 8.9 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 27 8.9 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 27 8.9 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 84.6 bits (200), Expect = 6e-17 Identities = 41/61 (67%), Positives = 49/61 (80%) Frame = -3 Query: 691 TITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 +I TG TKL +SNLD+GVS+ DIKELFSE G LK +HYDRSGRS GTA+VVF R+ DA Sbjct: 103 SIETG-TKLYISNLDYGVSNEDIKELFSEVGDLKRYGIHYDRSGRSKGTAEVVFSRRGDA 161 Query: 511 V 509 + Sbjct: 162 L 162 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -2 Query: 506 AMKQYNGVPLDGRAMNIQLATSEIN 432 A+K+YN V LDG+ M I++ + ++ Sbjct: 164 AVKRYNNVQLDGKLMKIEIVGTNLS 188 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/60 (63%), Positives = 48/60 (80%) Frame = -3 Query: 688 ITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 I TG TKL +SNLD+GV + DIKELF+E G LK +VH+DRSGRS GTA+VV+ R+ DA+ Sbjct: 82 IETG-TKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGRSKGTAEVVYSRRGDAL 140 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = -2 Query: 506 AMKQYNGVPLDGRAMNIQLATSEINTL-----RPEARNRIGGASVGGTIRNNPKRGGG 348 A+K+YN V LDG+ M I++ + + T RP N G GG R +RGGG Sbjct: 142 AVKKYNDVQLDGKPMKIEIVGTNLQTAAAPSGRPANGNSNGAPWRGGQGRGGQQRGGG 199 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/60 (63%), Positives = 48/60 (80%) Frame = -3 Query: 688 ITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 I TG TKL +SNLD+GV + DIKELF+E G LK +VH+DRSGRS GTA+VV+ R+ DA+ Sbjct: 18 IETG-TKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGRSKGTAEVVYSRRGDAL 76 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = -2 Query: 506 AMKQYNGVPLDGRAMNIQLATSEINTL-----RPEARNRIGGASVGGTIRNNPKRGGG 348 A+K+YN V LDG+ M I++ + + T RP N G GG R +RGGG Sbjct: 78 AVKKYNDVQLDGKPMKIEIVGTNLQTAAAPSGRPANGNSNGAPWRGGQGRGGQQRGGG 135 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/60 (63%), Positives = 48/60 (80%) Frame = -3 Query: 688 ITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 I TG TKL +SNLD+GV + DIKELF+E G LK +VH+DRSGRS GTA+VV+ R+ DA+ Sbjct: 84 IETG-TKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGRSKGTAEVVYSRRGDAL 142 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = -2 Query: 506 AMKQYNGVPLDGRAMNIQLATSEINTL-----RPEARNRIGGASVGGTIRNNPKRGGG 348 A+K+YN V LDG+ M I++ + + T RP N G GG R +RGGG Sbjct: 144 AVKKYNDVQLDGKPMKIEIVGTNLQTAAAPSGRPANGNSNGAPWRGGQGRGGQQRGGG 201 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 67.3 bits (157), Expect = 9e-12 Identities = 29/54 (53%), Positives = 44/54 (81%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 T+L V+NLD GV++ DI+ELFSE G ++ ++HYD++GR GTA+VV+ R++DA Sbjct: 93 TRLHVTNLDQGVTNEDIRELFSEIGEVERYAIHYDKNGRPSGTAEVVYPRRSDA 146 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -2 Query: 509 EAMKQYNGVPLDGRAMNIQLATSEINTLRP-EARNRIGGASVGGTIRNNP--KRGGGG 345 +A+K+YN V LDGR M +++ ++ P R + + G ++ ++GGGG Sbjct: 148 QALKKYNNVLLDGRPMRLEILGGNNSSEAPLSGRVNVNVTGLNGRLKRTVVIQQGGGG 205 >At1g66260.1 68414.m07522 RNA and export factor-binding protein, putative similar to GI:7159943 from [Mus musculus] (RNA 6 (4), 638-650 (2000)) Length = 295 Score = 65.3 bits (152), Expect = 4e-11 Identities = 26/56 (46%), Positives = 45/56 (80%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVR 506 T + ++NLD GV++ DI+EL++E G LK ++HYD++GR G+A+VV+ R++DA++ Sbjct: 107 TTVYITNLDQGVTNEDIRELYAEIGELKRYAIHYDKNGRPSGSAEVVYMRRSDAIQ 162 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 509 EAMKQYNGVPLDGRAMNIQLATSEINTLRPEARNRIGG 396 +AM++YN V LDGR M +++ + AR + G Sbjct: 162 QAMRKYNNVLLDGRPMKLEILGGNTESAPVAARVNVTG 199 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NSI 491 L V NLD V+D ++ELF+EFG + S V D SG S G+ V F ++A R+ N + Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSGTSKGSGFVAFSAASEASRVLNEM 388 Score = 28.3 bits (60), Expect = 5.1 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADA 512 L V +LDF V+DS + + F+E + S V D + SLG V + DA Sbjct: 48 LYVGDLDFNVTDSQLYDYFTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDA 100 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/70 (37%), Positives = 35/70 (50%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NS 494 T + V NL +D D+K F E+G + SA V D G+S G V FE DA R S Sbjct: 29 TNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVES 88 Query: 493 ITECHLMDEQ 464 + H D++ Sbjct: 89 LNG-HKFDDK 97 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 + L V NLD +SD +KE+FS FG + S+ V D +G S G+ V F +A Sbjct: 132 SNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEA 185 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGR-SLGTADVVFERKADAVR 506 L VSNLDF +++SDI LFS FG + +V DR R S G A V++ + DA + Sbjct: 59 LYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAK 113 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVR 506 T + V NL +SD ++ ++F EFG+ S + D G+S G V FE DA R Sbjct: 224 TNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFENSDDAAR 279 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 41.5 bits (93), Expect = 5e-04 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADAVRL*NS 494 +L V NL +GV D ++ LF+E G + A V YDR SGRS G V + + NS Sbjct: 250 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 309 Query: 493 ITECHLMDEQ 464 + L Q Sbjct: 310 LNGADLDGRQ 319 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKAD 515 KL V NL F V + + +LF G ++ V YD+ +GRS G V A+ Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAE 152 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 41.5 bits (93), Expect = 5e-04 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADAVRL*NS 494 +L V NL +GV D ++ LF+E G + A V YDR SGRS G V + + NS Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINS 317 Query: 493 ITECHLMDEQ 464 + L Q Sbjct: 318 LNGADLDGRQ 327 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKAD 515 KL V NL F V + + +LF G ++ V YD+ +GRS G V A+ Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAE 152 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 41.5 bits (93), Expect = 5e-04 Identities = 23/76 (30%), Positives = 37/76 (48%) Frame = -3 Query: 691 TITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 T +G + + NLD + + + E FS FG + S V D +GRS G V FE++ A Sbjct: 130 TRLSGKGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSKGYGFVQFEKEESA 189 Query: 511 VRL*NSITECHLMDEQ 464 + + + D+Q Sbjct: 190 QAAIDKLNGMLMNDKQ 205 Score = 40.7 bits (91), Expect = 9e-04 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVR 506 L + NLD V D +KE+FSE+G + S+ V + G S G V + +A+R Sbjct: 334 LYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYSNPEEALR 387 Score = 31.5 bits (68), Expect = 0.55 Identities = 20/68 (29%), Positives = 33/68 (48%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NS 494 + L +LD V+++ + +LF + S V D++ RSLG A + F DA R + Sbjct: 49 SSLYAGDLDPKVTEAHLFDLFKHVANVVSVRVCRDQNRRSLGYAYINFSNPNDAYRAMEA 108 Query: 493 ITECHLMD 470 + L D Sbjct: 109 LNYTPLFD 116 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 40.7 bits (91), Expect = 9e-04 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADAV 509 +KL + L + V + +K+ FS FG + + YD+ SGRS G V F + DA+ Sbjct: 41 SKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDAL 96 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 40.7 bits (91), Expect = 9e-04 Identities = 24/76 (31%), Positives = 36/76 (47%) Frame = -3 Query: 691 TITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 T +G + + NLD + + + E FS FG + S V D GRS G V FE++ A Sbjct: 126 TRLSGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETA 185 Query: 511 VRL*NSITECHLMDEQ 464 + + L D+Q Sbjct: 186 QAAIDKLNGMLLNDKQ 201 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 + L + NLD V+D +KE+FSE+G + S V + G S G V + +A+ Sbjct: 328 SNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEAL 382 Score = 34.7 bits (76), Expect = 0.059 Identities = 22/68 (32%), Positives = 35/68 (51%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NS 494 + L V +LD V++S + +LF++ + + V D + RSLG A V F DA R S Sbjct: 45 SSLYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRDLTHRSLGYAYVNFANPEDASRAMES 104 Query: 493 ITECHLMD 470 + + D Sbjct: 105 LNYAPIRD 112 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 ++ V NL +GV D ++ LFSE G + A V YDR SGRS G V ++ Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYD 253 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLG 548 KL V NL F V + + +LF G ++ V YD+ +GRS G Sbjct: 92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRG 133 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/55 (41%), Positives = 30/55 (54%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 T + V NL +D+D+K LF EFG + SA V D G+S V FE+ AV Sbjct: 119 TNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEGKSRRFGFVNFEKAEAAV 173 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 L V NLD V ++ ++ELFSEFG + S V +G S G V F +A Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEA 276 Score = 33.1 bits (72), Expect = 0.18 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -3 Query: 682 TGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVF 530 +G + V NLD + + + ++FS FG + S V D SG S G V F Sbjct: 28 SGRGNVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARDASGVSKGYGFVQF 78 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/65 (32%), Positives = 34/65 (52%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NS 494 TKL V N+ F + ++++LFS FG +KS + G+ G A V F K +A+ + Sbjct: 669 TKLHVKNIAFEATKRELRQLFSPFGQIKSMRLPKKNIGQYAGYAFVEFVTKQEALNAKKA 728 Query: 493 ITECH 479 + H Sbjct: 729 LASTH 733 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 37.5 bits (83), Expect = 0.008 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVR 506 T L + NLD VS+ ++E F+EFG + S ++ D + G A V F+ DA R Sbjct: 201 TNLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENRLCRGYAFVNFDNPEDARR 256 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/55 (25%), Positives = 30/55 (54%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 + + V N++ V++ ++++ FS+ G + S + D G+S G V F +A+ Sbjct: 304 SNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAI 358 Score = 30.7 bits (66), Expect = 0.96 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = -3 Query: 679 GPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERK 521 G + V NL V+++ ++++F +FG + S V G+S G V FE++ Sbjct: 110 GVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGKSRGYGFVQFEQE 162 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADA 512 TKL + L +G D+ +++ F+ FG + A V DR +GRS G V F + A Sbjct: 35 TKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAA 89 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADA 512 TKL + L +G D+ +++ F+ FG + A V DR +GRS G V F + A Sbjct: 35 TKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAA 89 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/67 (29%), Positives = 34/67 (50%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NSI 491 KL V L VS+++++ LFSE+G +K + S G + +E K AV ++ Sbjct: 110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEAL 169 Query: 490 TECHLMD 470 H+M+ Sbjct: 170 NGRHIME 176 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/67 (29%), Positives = 34/67 (50%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVRL*NSI 491 KL V L VS+++++ LFSE+G +K + S G + +E K AV ++ Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEAL 160 Query: 490 TECHLMD 470 H+M+ Sbjct: 161 NGRHIME 167 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 34.7 bits (76), Expect = 0.059 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -3 Query: 679 GPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 GP ++ V L + ++S ++EL FG LK + DR +G S G A V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQ 408 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 34.7 bits (76), Expect = 0.059 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -3 Query: 679 GPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 GP ++ V L + ++S ++EL FG LK + DR +G S G A V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQ 408 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 34.7 bits (76), Expect = 0.059 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -3 Query: 679 GPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 GP ++ V L + ++S ++EL FG LK + DR +G S G A V++ Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQ 408 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.10 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRS-GRSLGTADVVFERKADA 512 KL+V + + + +K+ S+FG L+ V DRS GRS G V F DA Sbjct: 4 KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDA 57 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLG 548 ++ V NL + V + +++LFSE G + A V YDR +GRS G Sbjct: 245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRG 286 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 33.9 bits (74), Expect = 0.10 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADAVRL*NS 494 KL + + + ++ +KE FS FG + A + DR +GR+ G VVF A A + Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIV--- 63 Query: 493 ITECHLMD 470 ITE H +D Sbjct: 64 ITEKHNID 71 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRS 563 K+ V L V++SD K F +FG V YD + Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHN 144 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 33.9 bits (74), Expect = 0.10 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADAVRL*NS 494 KL + + + ++ +KE FS FG + A + DR +GR+ G VVF A A + Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIV--- 63 Query: 493 ITECHLMD 470 ITE H +D Sbjct: 64 ITEKHNID 71 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRS 563 K+ V L V++SD K F +FG V YD + Sbjct: 109 KIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHN 144 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADA 512 +LVS + + DI F +FG +K+ +++ D RSG G A + +E+K +A Sbjct: 97 ILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEA 149 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 33.5 bits (73), Expect = 0.14 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = -3 Query: 685 TTGP-TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADA 512 ++GP TKL VS L F ++ +++ F +FG L ++ D+ + R G A + +E + +A Sbjct: 72 SSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEA 131 Query: 511 VR 506 ++ Sbjct: 132 MK 133 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 33.1 bits (72), Expect = 0.18 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAVR 506 T L ++NLD VS+ + +FS+FG + + + D G S G A + FE A R Sbjct: 17 TSLYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFRGESRGFAFIEFESADSAGR 72 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASV 578 T + V LD V+D D+K+ FSEFG + S + Sbjct: 306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKI 337 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 + V L + +D D++ FS+FG + + + DR SGRS G V F+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 + V L + +D D++ FS+FG + + + DR SGRS G V F+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 + V L + +D D++ FS+FG + + + DR SGRS G V F+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 + V L + +D D++ FS+FG + + + DR SGRS G V F+ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 32.3 bits (70), Expect = 0.31 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVF 530 T + V NL V+D + LFS++G + S V D GRS G V F Sbjct: 202 TNVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRDGMGRSRGFGFVNF 249 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVF 530 + L V NL ++++ ++E+F +G + SA V +GRS G V F Sbjct: 304 SNLYVKNLSESMNETRLREIFGCYGQIVSAKVMCHENGRSKGFGFVCF 351 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 32.3 bits (70), Expect = 0.31 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -3 Query: 682 TGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKADAVR 506 T TK+ V NL + + D++ F +FG + A+V + GRS G + F VR Sbjct: 9 TRVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVR 68 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -3 Query: 679 GPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 GP ++ V L + ++ I+EL FG L+ ++ DR +G S G A V++ Sbjct: 373 GPDRIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQ 424 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFG-ILKSASVHYDRSGRSLGTADVVFERKADA 512 + V+N+ FG + + F++FG +LK+ V +G+ G+A + F RK A Sbjct: 518 IFVANVHFGATKDSLSRHFNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAA 570 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 31.9 bits (69), Expect = 0.41 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERK 521 L V L+ D D+ +FS FG + SA V D ++G SL A + FE K Sbjct: 245 LFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENK 294 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASV 578 T + V LD V+D D+K+ F+EFG + S + Sbjct: 304 TTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKI 335 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -3 Query: 661 VSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERK 521 V LD + D+ ++FS+FG + + + YDR +G+S V FE + Sbjct: 11 VRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEE 58 >At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGR 557 TKL V N+ F + ++++LF+ FG +KS + GR Sbjct: 351 TKLHVKNIAFEATMKEVRQLFTPFGQIKSVGLPERTKGR 389 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.7 bits (66), Expect = 0.96 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 691 TITTGPTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKAD 515 T T TK+ V L + ++ F +FG + A V D+ +GRS G V F+ Sbjct: 16 TTDTKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Query: 514 AVR 506 A+R Sbjct: 76 AMR 78 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 30.7 bits (66), Expect = 0.96 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -3 Query: 676 PTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADA 512 PT LLV NL D+++ F +FG +K + D +G G V F ADA Sbjct: 35 PTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADA 90 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 685 TTGPTKLLVSNLDFGVSDSDIKELFSEFGILK 590 ++GP+ LL+ NL +D+++ F FG LK Sbjct: 43 SSGPSGLLIRNLPLDARPNDLRDSFERFGPLK 74 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELF--SEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 KL VSNL + + ++ELF ++F + + V D GRS G V F + +A Sbjct: 195 KLYVSNLAWKARSTHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEA 249 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFE 527 K+ V L V++++ K+ F++FG++ V YD R+ R G + ++ Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYD 82 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFE 527 K+ V L V++++ K+ F++FG++ V YD R+ R G + ++ Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYD 155 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVF 530 KL + + + S+ +++ F FG + A + DR +GR+ G VVF Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF 54 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFE 527 K+ V L V++++ K+ F++FG++ V YD R+ R G + ++ Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYD 155 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVF 530 KL + + + S+ +++ F FG + A + DR +GR+ G VVF Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF 54 >At1g05020.1 68414.m00503 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related Similar to clathrin assembly protein gb|X68878 (AP180) from Rattus norvegicus; contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; EST gb|W43552 comes from this gene Length = 653 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 658 SNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTA 542 S+LDFG S D E +S++G +S S+ S GT+ Sbjct: 359 SSLDFGDSTIDTSERYSDYGSFRSTSLEDLMSRTEAGTS 397 >At4g27330.1 68417.m03921 sporocyteless (SPL) identical to sporocyteless SPL (MADS-box related protein) [Arabidopsis thaliana] gi|5566240|gb|AAD45344 Length = 314 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -2 Query: 470 RAMNIQLATSEINTLRPEARNRIGGAS-VGGTIRNNPKRGGGGIR 339 RA ++ +++ IN EA N G G + NP+ G GG++ Sbjct: 233 RAASVSASSTTINPYFNEATNHTGPMEEFGSYMEGNPRNGSGGVK 277 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = -3 Query: 676 PTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADA 512 PT LLV NL D++ F +FG +K + D +G G + F ADA Sbjct: 36 PTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADA 91 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 T++ V NLD V++ ++++ F FG+L++ V + R G A + F+ + DA+ Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWV----ARRPPGYAFLEFDDERDAL 52 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 T++ V NLD V++ ++++ F FG+L++ V + R G A + F+ + DA+ Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWV----ARRPPGYAFLEFDDERDAL 52 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = -3 Query: 661 VSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 V N D+ SD++ LFS+FG +K R G A V FE + DA Sbjct: 6 VGNFDYDTRHSDLERLFSKFGRVK-------RVDMKSGYAFVYFEDERDA 48 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 KL V +L+ ++ +++E+F +FG ++ + D +S G V + K A+ Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAM 265 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADAV 509 KL V +L+ ++ +++E+F +FG ++ + D +S G V + K A+ Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVKYSSKETAM 265 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRS-GRSLGTADVVFERKADA 512 L V +L V+++ +KE+F FG + + DR+ G V F+ +ADA Sbjct: 100 LHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADA 152 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRS-GRSLGTADVVFERKADA 512 L V +L V+++ +KE+F FG + + DR+ G V F+ +ADA Sbjct: 100 LHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADA 152 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADAV 509 K+ V L +++ + K F +FG + V YD + R G + F+ DAV Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD-SDDAV 164 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADAV 509 K+ V L +++ + K F +FG + V YD + R G + F+ DAV Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD-SDDAV 164 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFERKADAV 509 K+ V L +++ + K F +FG + V YD + R G + F+ DAV Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD-SDDAV 164 >At5g24910.1 68418.m02949 cytochrome P450 family protein similar to Cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; similar to fatty acid omega-hydroxylase cytochrome P450 4A11 - Homo sapiens, PIR:I53015; supported by cDNA: gi_16604323_gb_AY058060.1_ Length = 532 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -3 Query: 664 LVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERK 521 ++S FG S S KE+FS+ L+ A H + G DVVF K Sbjct: 221 VISRACFGSSFSKGKEIFSKLRCLQKAITHNNILFSLNGFTDVVFGTK 268 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYD-RSGRSLGTADVVFE 527 K+ V L +++++ K F +FG + V YD + R G + F+ Sbjct: 123 KIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFD 171 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDRSGRSLGTADVVFERKADA 512 +++ V NLD V++ ++++ F FG+++S V + R G A + FE DA Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWV----ARRPPGYAFLDFEDSRDA 51 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 676 PTKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFE 527 P+K+ V L +KE F FG + A V DR SG S G V ++ Sbjct: 35 PSKIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYD 85 >At4g17720.1 68417.m02646 RNA recognition motif (RRM)-containing protein Length = 313 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFG 599 T + VSN+ G +D D+KE FS G Sbjct: 4 TTVKVSNVSLGATDRDLKEFFSFSG 28 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 670 KLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVF 530 K+ VSN+ + + E FS FG ++ + D+ +GR G A V+ Sbjct: 228 KIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVY 275 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVFERKAD 515 TKL NL + V + + ++ +F + V Y+R +G+S G A V D Sbjct: 85 TKLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSNVED 138 >At1g51460.1 68414.m05792 ABC transporter family protein similar to SP|Q9UNQ0 ATP-binding cassette, sub-family G, member 2 (Placenta-specific ATP- binding cassette transporter) (Breast cancer resistance protein) {Homo sapiens}; contains Pfam profile PF00005: ABC transporter Length = 678 Score = 27.9 bits (59), Expect = 6.8 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 680 WSYQAACIQFGLWSIRFRYKGTIFGI 603 W Y + I +G W+++ YK + G+ Sbjct: 545 WRYPVSYINYGAWALQGAYKNEMIGV 570 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 667 LLVSNLDFGVSDSDIKELFSEFGILKS 587 LLV N+ V D ++K LF +FG +++ Sbjct: 219 LLVGNISSNVEDYELKVLFEQFGDIQA 245 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVF 530 TK+ V L + ++ F +FG + A V D+ SGRS G V F Sbjct: 7 TKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 673 TKLLVSNLDFGVSDSDIKELFSEFGILKSASVHYDR-SGRSLGTADVVF 530 TK+ V L + ++ F +FG + A V D+ SGRS G V F Sbjct: 7 TKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,219,078 Number of Sequences: 28952 Number of extensions: 209234 Number of successful extensions: 673 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -