BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30723 (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0606 + 24297392-24299241,24299424-24299484,24299626-24300087 28 6.4 10_08_0008 - 14046647-14047462,14050744-14051499 28 8.5 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 28 8.5 >02_04_0606 + 24297392-24299241,24299424-24299484,24299626-24300087 Length = 790 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +1 Query: 508 LDSKINEQPSIQYIIQLKESGRTIQAANMAFQLANVEASKNASPLRIKKLYILAG 672 LD+ + S+QY +++ + I+ + L +V+AS+ KK+ +L G Sbjct: 96 LDAAQKQAASLQYEVRMLQKELEIRGQEREYDLQSVDASRRQQAESQKKIALLEG 150 >10_08_0008 - 14046647-14047462,14050744-14051499 Length = 523 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -2 Query: 556 VVLYTVWRAAHLFYCPEFSVILF*FCILCGSR 461 VVL V+RA Y P+F + L FCI G R Sbjct: 378 VVLKRVFRADVKAYLPDFKLALDHFCIHAGGR 409 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 425 DNESLSKLFISSPRTAKDTKLKQNDAEL 508 D+ESLS + S P TA D LK + EL Sbjct: 468 DSESLSTKYCSGPNTAADAGLKPDVYEL 495 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,682,495 Number of Sequences: 37544 Number of extensions: 366730 Number of successful extensions: 738 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -