BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30723 (716 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.54 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.7 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.8 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 0.54 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 1/75 (1%) Frame = +2 Query: 317 QYWDFYIDRQNWSGALEY-YKMSNNTEGLKKCYMALEDNESLSKLFISSPRTAKDTKLKQ 493 + W+ ID + + L Y + M N YM LE E + S+ +K Sbjct: 1091 EMWEL-IDTEKLTDRLPYPWTMDNERYVKVDMYMNLE-GEQKDPVIFSTSFDSKVMTRPD 1148 Query: 494 NDAELWTVK*MSSPP 538 D+E WT K M+ P Sbjct: 1149 TDSENWTPKMMAVEP 1163 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 547 YTVWRAAHLFYCPEFSVILF*FCILCGSRR 458 Y ++ FY P F +I + I C +RR Sbjct: 202 YQIYATLGSFYIPLFVMIQVYYKIFCAARR 231 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 6.7 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 41 ASKRPKLRLLGEMITQELNLCRD*MHYIPVPL-RKPK*WHISKT 169 A+ +P R GE QEL + + +P+PL R P S T Sbjct: 536 AAGQPSKRNGGETNKQELKRLKSTVSLLPLPLARTPSVMSASST 579 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 495 FCFNFVSFAVLGELMNNL 442 F F+ V+F +LG +NNL Sbjct: 394 FNFDEVNFRILGANVNNL 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,153 Number of Sequences: 438 Number of extensions: 4123 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -