BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30722 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 29 0.19 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 29 0.19 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 29 0.19 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 29 0.19 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 29 0.19 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 29 0.19 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 29 0.19 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 29 0.19 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 29 0.19 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 29 0.19 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 29 0.19 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 29 0.19 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 29 0.19 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 29 0.19 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 29 0.19 AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 28 0.34 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 27 0.78 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 25 1.8 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 25 3.2 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 7.3 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 23 9.6 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 23 9.6 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 9.6 AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse t... 23 9.6 AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse t... 23 9.6 AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse t... 23 9.6 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 74 SRHTPQIIMFYADWCFACMK 93 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 74 SRHTPQIIMFYADWCFACMK 93 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 76 SRHTPQIIMFYADWCFACMK 95 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 76 SRHTPQIIMFYADWCFACMK 95 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 79 SRHTPQIIMFYADWCFACMK 98 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 79 SRHTPQIIMFYADWCFACMK 98 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 89 SRHTPQIIMFYADWCFACMK 108 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 91 SRHTPQIIMFYADWCFACMK 110 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 91 SRHTPQIIMFYADWCFACMK 110 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 73 SRHTPQIIMFYADWCFACMK 92 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 73 SRHTPQIIMFYADWCFACMK 92 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 28.7 bits (61), Expect = 0.19 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 183 SQHDTALVMFYAPWCGHCKR 242 S+H ++MFYA WC C + Sbjct: 88 SRHTPQIIMFYADWCFACMK 107 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 27.9 bits (59), Expect = 0.34 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +3 Query: 165 DFSAVLSQHDTALVM--FYAPWCGHCKRLKPE 254 DF+ L LV+ F+A WCG CK + P+ Sbjct: 10 DFNNKLEAAGDQLVVVDFFATWCGPCKVIAPK 41 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 26.6 bits (56), Expect = 0.78 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 338 YSCHLPYSLL*LAPPEGHRSSTGRRLQRLW 249 Y H+P ++L P+ H ++ R+ R+W Sbjct: 476 YLFHIPAAMLVPVSPDSHANTVSSRVVRMW 505 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 309 LASATGGSSVFNRPAATASLALVSYNDRTKAR 214 L G+ +F+R A +S ALV Y +T+ R Sbjct: 227 LVLTDAGAGLFHRAIAQSSTALVPYAFQTRPR 258 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 25.4 bits (53), Expect = 1.8 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 318 VRKVARVLVNNSLCPDILH*KSSEKENFLPSTMDQGSLMALSSTC 452 +RKVA + NN LC + ++ L + M G L TC Sbjct: 281 LRKVALNIYNNELCAERYRYDRHLRQGILSTQMCVGDLAGGKDTC 325 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 24.6 bits (51), Expect = 3.2 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -1 Query: 387 LKIFSVGYPDTENCSQVLLPPSVQSTLASATGGSSVFNRPAATASLALVSYND 229 +K+F +P + + ++ P VQS L+ G+S R + L L + ND Sbjct: 135 VKLFQKAFPSDDTSNYIISPIMVQSLLSYLFDGASNATRLEMESVLQL-NMND 186 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 198 ALVMFYAPWCGHCKRL 245 A+V YAP C CK + Sbjct: 20 AMVFAYAPTCARCKSI 35 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.0 bits (47), Expect = 9.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 703 TCSGVAWDDTRPHCFC 656 TCSG++ + R C+C Sbjct: 226 TCSGISTEVCRRSCYC 241 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 23.0 bits (47), Expect = 9.6 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = -2 Query: 683 GRYKTTLFLYPVFSRTSLAEE*AKVTSSLNLSAVLRNSPFRSDSFSKNPTTTTSSLEVKL 504 GR + SR + A ++ + LS++LR RSD N L +KL Sbjct: 194 GRSTNVFIPFSAGSRNCIGGRYAMLSMKVMLSSILRRLRLRSD-LQMNDLQFRFDLTLKL 252 Query: 503 QNQ 495 +++ Sbjct: 253 ESE 255 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +2 Query: 296 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELS 403 + L +D +GG + + ++ T+ + R GEL+ Sbjct: 28 IKLEYIDLFKGGHLSSDYLKINPLHTVPVLRHGELT 63 >AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 318 VRKVARVLVNNSLCPDILH*KSSEKENFLPSTMDQGSLMALSSTCVPKLD 467 + KV +LV L + S + F+P+ +LM S+C +D Sbjct: 11 IAKVLELLVYEPLLASARNYISPNQHGFVPNRSTTTNLMQFVSSCHKSID 60 >AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 318 VRKVARVLVNNSLCPDILH*KSSEKENFLPSTMDQGSLMALSSTCVPKLD 467 + KV +LV L + S + F+P+ +LM S+C +D Sbjct: 11 IAKVLELLVYEPLLASARNYISPNQHGFVPNRSTTTNLMQFVSSCHKSID 60 >AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 318 VRKVARVLVNNSLCPDILH*KSSEKENFLPSTMDQGSLMALSSTCVPKLD 467 + KV +LV L + S + F+P+ +LM S+C +D Sbjct: 11 IAKVLELLVYEPLLASARNYISPNQHGFVPNRSTTTNLMQFVSSCHKSID 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,187 Number of Sequences: 2352 Number of extensions: 15625 Number of successful extensions: 78 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -