BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30721 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 3.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.2 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = -2 Query: 356 PTFLDYFVNGVSLVYCKAFNDSELPQI*LHLYWH*PNTCGLRFANTPQNVK 204 P + + +NG S L + +LY+ ++ L + NT Q VK Sbjct: 233 PRYTTFTINGESFTLQSGIFGMALSPLTQNLYYSALSSHNLNYVNTEQFVK 283 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 228 CEYASKRQNFRRVRS*RTWDKRK 160 C+ + R +RS TWD R+ Sbjct: 1664 CDRIKRGTVIRSIRSHSTWDPRR 1686 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,323 Number of Sequences: 438 Number of extensions: 3092 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -