BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30714 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 29 0.10 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 29 0.10 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 29 0.10 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 29 0.10 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 29 0.10 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 29 0.10 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 29 0.10 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 29 0.10 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 29 0.10 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 29 0.10 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 29 0.10 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 29 0.10 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 29 0.10 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 29 0.10 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 29 0.10 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 29 0.10 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 29 0.10 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 29 0.10 AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 25 1.7 AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse t... 25 2.2 AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse t... 25 2.2 AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse t... 25 2.2 AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 25 2.2 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 3.0 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 6.8 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 9.0 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 74 SRHTPQIIMFYADWCFACMKAANS 97 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 74 SRHTPQIIMFYADWCFACMKAANS 97 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 76 SRHTPQIIMFYADWCFACMKAANS 99 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 76 SRHTPQIIMFYADWCFACMKAANS 99 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 79 SRHTPQIIMFYADWCFACMKAANS 102 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 79 SRHTPQIIMFYADWCFACMKAANS 102 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 89 SRHTPQIIMFYADWCFACMKAANS 112 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 91 SRHTPQIIMFYADWCFACMKAANS 114 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 91 SRHTPQIIMFYADWCFACMKAANS 114 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 73 SRHTPQIIMFYADWCFACMKAANS 96 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 73 SRHTPQIIMFYADWCFACMKAANS 96 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.10 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 188 SQHDTALVMFYAPWCGHCKRLKQS 259 S+H ++MFYA WC C + S Sbjct: 88 SRHTPQIIMFYADWCFACMKAANS 111 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +2 Query: 170 DFSAVLSQHDTALVM--FYAPWCGHCK 244 DF+ L LV+ F+A WCG CK Sbjct: 10 DFNNKLEAAGDQLVVVDFFATWCGPCK 36 >AJ970248-1|CAI96720.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 25.0 bits (52), Expect = 2.2 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 322 VRKVARVLVNNSLCPDILH*KSSEKENFLPNTMDQGSLMALSSTCVPKLD 471 + KV +LV L + S + F+PN +LM S+C +D Sbjct: 11 IAKVLELLVYEPLLASARNYISPNQHGFVPNRSTTTNLMQFVSSCHKSID 60 >AJ970247-1|CAI96719.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 25.0 bits (52), Expect = 2.2 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 322 VRKVARVLVNNSLCPDILH*KSSEKENFLPNTMDQGSLMALSSTCVPKLD 471 + KV +LV L + S + F+PN +LM S+C +D Sbjct: 11 IAKVLELLVYEPLLASARNYISPNQHGFVPNRSTTTNLMQFVSSCHKSID 60 >AJ970246-1|CAI96718.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 25.0 bits (52), Expect = 2.2 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 322 VRKVARVLVNNSLCPDILH*KSSEKENFLPNTMDQGSLMALSSTCVPKLD 471 + KV +LV L + S + F+PN +LM S+C +D Sbjct: 11 IAKVLELLVYEPLLASARNYISPNQHGFVPNRSTTTNLMQFVSSCHKSID 60 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 25.0 bits (52), Expect = 2.2 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +1 Query: 322 VRKVARVLVNNSLCPDILH*KSSEKENFLPNTMDQGSLMALSSTC 456 +RKVA + NN LC + ++ L M G L TC Sbjct: 281 LRKVALNIYNNELCAERYRYDRHLRQGILSTQMCVGDLAGGKDTC 325 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 288 R*PSGGATKVDCTEGGKS 341 R PSGG + DCTE G S Sbjct: 495 RTPSGGCYEGDCTEKGGS 512 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 203 ALVMFYAPWCGHCKRL 250 A+V YAP C CK + Sbjct: 20 AMVFAYAPTCARCKSI 35 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.0 bits (47), Expect = 9.0 Identities = 18/59 (30%), Positives = 25/59 (42%) Frame = -3 Query: 553 FEESDNHYFILXXXXXXXXXXXXSLELGPTWARMYLTMPLDSLGPLYSEESSPFLKIFS 377 FE D HYF+L + ++ W R+ T L +L +S E P L I S Sbjct: 35 FEHYDKHYFVLPINNKDKWYRTCNRQINQQWKRI-RTERLKTLE--HSPEMPPSLIIAS 90 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,478 Number of Sequences: 2352 Number of extensions: 13251 Number of successful extensions: 70 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -