BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30708 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) 56 2e-08 SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 33 0.22 SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) 33 0.22 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_282| Best HMM Match : zf-CCCH (HMM E-Value=2.4e-10) 32 0.50 SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_11068| Best HMM Match : bZIP_1 (HMM E-Value=9.2) 32 0.50 SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_58596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 29 2.7 SB_58506| Best HMM Match : Vps52 (HMM E-Value=0.099) 29 4.7 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 29 4.7 SB_56601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_52346| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.3) 28 6.2 SB_40320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 28 8.1 SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) 28 8.1 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) 28 8.1 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 62.1 bits (144), Expect = 4e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +2 Query: 509 VKDEPQTVPSAASTPPLSPIDMDTQEKIKLERKRQRNRVAASKCRRRKL 655 ++++ Q VP TPPL PID+D QE +K ERK+ RNR+AASKCR+RKL Sbjct: 109 MEEQSQVVPH---TPPLPPIDLDLQEAVKNERKKLRNRLAASKCRKRKL 154 >SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) Length = 382 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = +2 Query: 512 KDEPQTVP---SAASTPPLSPIDMDTQEKIKLERKRQRNRVAASKCRRRKL 655 K E Q P S PL PID++ QE +K ERK+Q+NRVAASKCRR+KL Sbjct: 276 KYEEQAAPPHNSGLGGLPLPPIDLELQEIVKRERKKQKNRVAASKCRRKKL 326 >SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 54.8 bits (126), Expect = 6e-08 Identities = 28/61 (45%), Positives = 38/61 (62%) Frame = +2 Query: 473 FGQAARAIPHSHVKDEPQTVPSAASTPPLSPIDMDTQEKIKLERKRQRNRVAASKCRRRK 652 +G + + K E QT S L PID++ QE +K ERK+QRNR+A+SKCR+RK Sbjct: 439 YGNVVKQEIPGNFKLESQTTESGV----LQPIDLEIQEVVKRERKKQRNRIASSKCRKRK 494 Query: 653 L 655 L Sbjct: 495 L 495 Score = 32.7 bits (71), Expect = 0.29 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = +3 Query: 261 MLKLGSPELEKLI--IQNGMVXXXXXXXXXXVLF--PAVAPTEEQEMYARPFVEALDKLH 428 +LKL SP++EK++ +Q+G+ P PT EQ Y+R F EAL LH Sbjct: 259 LLKLASPDIEKMLMSLQSGISASPTPGSLFNSTAHGPVNPPTTEQ--YSRGFTEALQDLH 316 Query: 429 HGEA 440 +A Sbjct: 317 DRQA 320 >SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) Length = 539 Score = 33.1 bits (72), Expect = 0.22 Identities = 21/92 (22%), Positives = 41/92 (44%) Frame = +2 Query: 362 SSTYGGTRNVCATFRRSARQAAPRRGSDAARTSSICRFGQAARAIPHSHVKDEPQTVPSA 541 ++ Y +R+ + +R AR GS + +SS + +K P+++P Sbjct: 259 AANYPSSRSASMSIKRPARPERSTAGSTSTESSSSAASSVTVASDTGYQMKSPPESLP-- 316 Query: 542 ASTPPLSPIDMDTQEKIKLERKRQRNRVAASK 637 S PPL P D + + + R R+ +A++ Sbjct: 317 -SPPPLPPQDYEEEPLHNKRKVRPRHERSATE 347 >SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) Length = 496 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/23 (52%), Positives = 20/23 (86%) Frame = +2 Query: 584 EKIKLERKRQRNRVAASKCRRRK 652 E++K+ R+RQRN+ AAS+CR ++ Sbjct: 286 EELKIIRRRQRNKQAASRCREKR 308 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 31.9 bits (69), Expect = 0.50 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 428 PRRGSDAARTSSICRFG-QAARAIPHSHVKDEPQTVPSAASTPPLSPIDMDTQEKIKLER 604 P + D + S++ R Q ++ I VK + ++ +TPP SP +D +IK+ER Sbjct: 793 PVQEVDDNKPSNVYRMARQYSKRITDDKVKQDIRSRSRGENTPPKSPTRLDLSPRIKIER 852 >SB_282| Best HMM Match : zf-CCCH (HMM E-Value=2.4e-10) Length = 508 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 494 IPHSHVKDEPQTVPSAASTPPLSPIDMDTQEKIKLERKRQRNRVAASKCR 643 +P + DEP V SA + PL+PI+ ++K+ ++ N KCR Sbjct: 10 VPRHKMADEPAQVASAENKLPLTPIENARRQKVCRFYAKKGNCRFGEKCR 59 >SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +2 Query: 569 DMDTQEKIKLERKRQRNRVAASKCRRRK 652 ++ +E+ + + +RQRN+VAASKCR ++ Sbjct: 78 ELTPEEETRRKVRRQRNKVAASKCRLKR 105 >SB_11068| Best HMM Match : bZIP_1 (HMM E-Value=9.2) Length = 106 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +2 Query: 569 DMDTQEKIKLERKRQRNRVAASKCRRRK 652 ++ +E+ + + +RQRN+VAASKCR ++ Sbjct: 70 ELTPEEETRRKVRRQRNKVAASKCRLKR 97 >SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 31.5 bits (68), Expect = 0.66 Identities = 25/79 (31%), Positives = 31/79 (39%) Frame = +1 Query: 382 KKCMRDLSSKR*TSCTTARQ*RRSDVEYMPIWTGR*SDTPLPCEGRAPDGAERGQHAAAI 561 KKC + T+C TA Q R WT C R DG R +H Sbjct: 550 KKCQCEAGYDPSTNCETALQARDGGFGAWSEWTN--------CS-RGCDGGNRRRHRFCN 600 Query: 562 THRHGHSGKDQTGEKETEE 618 + H GKD +GE+ EE Sbjct: 601 SPYPAHGGKDCSGERIQEE 619 >SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.5 bits (68), Expect = 0.66 Identities = 17/38 (44%), Positives = 28/38 (73%) Frame = +2 Query: 539 AASTPPLSPIDMDTQEKIKLERKRQRNRVAASKCRRRK 652 A ST ++P + +E+ KL +R+RN+VAASKCR+++ Sbjct: 87 AESTEMVTP---EEEERRKL--RRERNKVAASKCRQKR 119 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +2 Query: 575 DTQEKIKLERKRQRNRVAASKCRRRKLGTYFQSWKRK 685 + QE++K ++K + + + + + YF+SWK K Sbjct: 813 EKQERLKAKKKEEEEKELEKRSKTKDAKKYFESWKSK 849 >SB_58596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 534 GTVWGSSFTWEWGIALAACPNRHILDV 454 G++ G + WE GIA+A C H+L+V Sbjct: 60 GSIHGEAHVWEGGIAIAGC-KFHLLEV 85 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 482 AARAIPHSHVKDEPQTVPSAASTPPLSPI 568 +A + P++ P T PSA+S+P +SPI Sbjct: 1221 SATSPPYTSASPVPTTTPSASSSPTISPI 1249 >SB_58506| Best HMM Match : Vps52 (HMM E-Value=0.099) Length = 775 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 359 RSSTYGGTRNVCATFRRSARQAAPRRGSDAARTSS 463 R ST GGTR+ ATF+ + A R A+ SS Sbjct: 210 RLSTKGGTRSAIATFKMTVASPAKSREDTASLRSS 244 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/67 (29%), Positives = 27/67 (40%) Frame = +2 Query: 356 SRSSTYGGTRNVCATFRRSARQAAPRRGSDAARTSSICRFGQAARAIPHSHVKDEPQTVP 535 SR + G T ++ + PR + T SI + AIP H+ P T P Sbjct: 227 SRQNVSGQAGPTNMTQSSTSHSSTPRHHGEPQTTISITSI--ISSAIPRGHLPTTPSTTP 284 Query: 536 SAASTPP 556 A TPP Sbjct: 285 QA--TPP 289 >SB_56601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +2 Query: 494 IPHSHVKDEPQTVPSAASTPPLSPIDMDTQEKIK 595 +PH+ V+ PQT+P+ T P ++ ++E ++ Sbjct: 168 MPHTAVQQSPQTLPTPTHTTPRVDPEITSEESLE 201 >SB_52346| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.3) Length = 178 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +2 Query: 500 HSHVKDEP--QTVPSAASTPPLSPIDMDTQEKIKLERKRQRNRVAASKCRRRKLGTYF 667 H +K+EP + + S+AST P T+E KL+ K + S+ RKL + Sbjct: 120 HIFIKEEPKQEILQSSASTLCDKPTGSSTEELKKLQSKVEELEEQTSRLTTRKLNLQY 177 >SB_40320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 326 YPYSGSACLISRSSTYGGTRNVCATFRRSARQAAPRRGSDAARTSSI 466 +PY S+ SRSS GG + T + + R++ + G +T + Sbjct: 33 HPYPTSSRASSRSSARGGAKTTKTTKKCTTRKSRTQNGDTTTKTKCV 79 >SB_21723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +2 Query: 494 IPHSHVKDEPQTVPSAASTPPLSPIDMDTQEKIK 595 +PH+ V+ PQT+P+ T P ++ ++E ++ Sbjct: 296 MPHTAVQQSPQTLPTPTHTTPRVDPEITSEESLE 329 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 27.9 bits (59), Expect = 8.1 Identities = 24/84 (28%), Positives = 37/84 (44%) Frame = +2 Query: 404 RRSARQAAPRRGSDAARTSSICRFGQAARAIPHSHVKDEPQTVPSAASTPPLSPIDMDTQ 583 ++ ARQA PR+ S +TS P H K + ++ T P D D Q Sbjct: 754 KQVARQARPRQASRKTKTSK-----------PQDHGKQATRPRQASHKTRTKKPQDQDKQ 802 Query: 584 EKIKLERKRQRNRVAASKCRRRKL 655 E+ +++ R R A+ K + KL Sbjct: 803 EQ---DKQAARPRHASCKTKASKL 823 >SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) Length = 575 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 498 GIALAACPNRHILDVRAASLPRRGAACLALRRKVAHTFLVP 376 G+ +AAC +H+ D+RA L R + L L V F VP Sbjct: 82 GLLMAACKVQHLGDIRANILHPRNVSSLVLH--VVAGFTVP 120 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +2 Query: 512 KDEPQTVPSAASTPPL---SPIDMDTQEKIKLERKRQRNRVAASKCRRRK 652 +DE + +PS A+ PPL P TQ ++ E ++R + K +R + Sbjct: 948 EDEYEILPSEAAAPPLPDTRPGASPTQSEVDAEESKKREKKDKEKEKRER 997 >SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) Length = 1348 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 254 SGE-ERTGAAIRERFPPRPTSKVRGLLRFSTGPLR 153 SGE R G+ I+E PPRP K R + + PL+ Sbjct: 380 SGEGPRHGSLIKEE-PPRPPQKTRPMNEYQESPLK 413 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,059,440 Number of Sequences: 59808 Number of extensions: 502931 Number of successful extensions: 1538 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1532 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -